Comparing SMc00676 SMc00676 amino acid-binding periplasmic signal peptide protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
58% identity, 96% coverage: 15:331/331 of query aligns to 4:324/324 of 4z9nB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
33% identity, 64% coverage: 17:228/331 of query aligns to 1:202/229 of 5t0wA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
30% identity, 65% coverage: 25:240/331 of query aligns to 3:209/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 65% coverage: 25:240/331 of query aligns to 3:211/226 of 4zv1A
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
27% identity, 64% coverage: 18:228/331 of query aligns to 6:208/251 of 1xt8B
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
24% identity, 68% coverage: 14:237/331 of query aligns to 4:229/278 of 2ia4B
2vhaA Debp (see paper)
24% identity, 68% coverage: 14:237/331 of query aligns to 3:228/276 of 2vhaA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 68% coverage: 16:240/331 of query aligns to 1:217/247 of 2yjpA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
31% identity, 69% coverage: 8:237/331 of query aligns to 34:254/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
31% identity, 69% coverage: 8:237/331 of query aligns to 34:254/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
31% identity, 69% coverage: 8:237/331 of query aligns to 35:255/288 of 6h2tA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
27% identity, 58% coverage: 50:240/331 of query aligns to 38:220/243 of 5eyfB
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
24% identity, 68% coverage: 14:237/331 of query aligns to 1:226/503 of 8ovoA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
29% identity, 61% coverage: 25:226/331 of query aligns to 3:198/234 of 3k4uE
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
25% identity, 65% coverage: 19:233/331 of query aligns to 3:211/231 of 2v25A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 66% coverage: 19:237/331 of query aligns to 3:210/229 of 6svfA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
29% identity, 42% coverage: 45:184/331 of query aligns to 23:152/224 of 4ymxA
Sites not aligning to the query:
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
26% identity, 54% coverage: 11:189/331 of query aligns to 2:170/241 of 3vvfA
Sites not aligning to the query:
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
26% identity, 54% coverage: 11:189/331 of query aligns to 2:170/241 of 3vveA
Sites not aligning to the query:
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
26% identity, 54% coverage: 11:189/331 of query aligns to 2:170/241 of 3vvdA
Sites not aligning to the query:
>SMc00676 SMc00676 amino acid-binding periplasmic signal peptide protein
MALFATAFLAGTTAQAATLDVVKQRGELRCGVSQGVLGFSAPDDKGEWSGFDIDFCRAVA
AATLGSPDKVKYVPLSTKERFTALQSGEVDLLSRQTTWTLSRDTDLGMSFVGVNYYDGQA
FMVRGDIGVKSVKELSGASVCTETGTTTEQNMADYFSANKIEYQVIAFEKADQTIQAFNS
GRCDVYSTDASALYSQRLTLNDPDRFVVLPEVISKEPLGPAVRQGDDQWFKVVRWTLFAM
IEAEELGITRENAASLLESGTAAQKRFLGIDNEAGKALGLDPKWAYQTVAAVGNYGEIFE
RHLGKESALRIDRGLNKLWNNGGLIYAPPVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory