SitesBLAST
Comparing SMc00677 FitnessBrowser__Smeli:SMc00677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
50% identity, 40% coverage: 609:1010/1017 of query aligns to 1:402/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
42% identity, 42% coverage: 588:1012/1017 of query aligns to 1:421/423 of 5g4jA
- active site: S14 (≠ L601), Y130 (= Y717), D201 (≠ E792), D234 (= D825), Q237 (= Q828), K264 (= K855), T294 (= T885), K395 (= K986)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (≠ F631), R73 (= R660), G103 (= G690), S104 (= S691), Y130 (= Y717), H131 (= H718), D234 (= D825), V236 (= V827), Q237 (= Q828), K264 (= K855), T294 (= T885), R397 (= R988)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
42% identity, 42% coverage: 588:1012/1017 of query aligns to 1:421/423 of 5g4iA
- active site: S14 (≠ L601), Y130 (= Y717), D201 (≠ E792), D234 (= D825), Q237 (= Q828), K264 (= K855), T294 (= T885), K395 (= K986)
- binding pyridoxal-5'-phosphate: G103 (= G690), S104 (= S691), H131 (= H718), D234 (= D825), V236 (= V827), Q237 (= Q828), K264 (= K855)
- binding phosphate ion: Y44 (≠ F631), R397 (= R988)
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
33% identity, 39% coverage: 616:1012/1017 of query aligns to 34:432/439 of 5wyaA
- active site: Y140 (= Y717), E215 (= E792), D248 (= D825), N251 (≠ Q828), K278 (= K855), T307 (≠ N884), R406 (≠ K986)
- binding (2S,3S)-3-methyl-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pentanoic acid: A52 (≠ V634), Y82 (≠ R660), S112 (= S689), G113 (= G690), S114 (= S691), Y140 (= Y717), H141 (= H718), E215 (= E792), D248 (= D825), V250 (= V827), N251 (≠ Q828), K278 (= K855), F306 (= F883), T307 (≠ N884), R406 (≠ K986)
Sites not aligning to the query:
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
33% identity, 39% coverage: 616:1012/1017 of query aligns to 43:441/448 of 4ysnC
- active site: Y149 (= Y717), E224 (= E792), D257 (= D825), N260 (≠ Q828), K287 (= K855), T316 (≠ N884), R415 (≠ K986)
- binding pyridoxal-5'-phosphate: S121 (= S689), G122 (= G690), S123 (= S691), Y149 (= Y717), H150 (= H718), E224 (= E792), D257 (= D825), V259 (= V827), K287 (= K855), F315 (= F883), T316 (≠ N884)
Sites not aligning to the query:
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
33% identity, 39% coverage: 616:1012/1017 of query aligns to 36:434/446 of 5wyfA
- active site: Y142 (= Y717), E217 (= E792), D250 (= D825), N253 (≠ Q828), K280 (= K855), T309 (≠ N884), R408 (≠ K986)
- binding n-[o-phosphono-pyridoxyl]-isoleucine: A54 (≠ V634), Y84 (≠ R660), G115 (= G690), S116 (= S691), Y142 (= Y717), H143 (= H718), D222 (≠ V797), D250 (= D825), V252 (= V827), N253 (≠ Q828), K280 (= K855), F308 (= F883), T309 (≠ N884), R408 (≠ K986)
Sites not aligning to the query:
5m4bA Alpha-amino epsilon-caprolactam racemase d210a mutant in complex with plp and geminal diamine intermediate
33% identity, 40% coverage: 608:1009/1017 of query aligns to 27:422/439 of 5m4bA
- active site: Y140 (= Y717), E208 (= E792), D241 (= D825), K244 (≠ Q828), K270 (= K855), T298 (= T885), E399 (≠ K986)
- binding [6-methyl-5-oxidanyl-4-[(~{E})-[(3~{R})-2-oxidanylideneazepan-3-yl]iminomethyl]pyridin-3-yl]methyl dihydrogen phosphate: W53 (vs. gap), S112 (= S689), G113 (= G690), S114 (= S691), Y140 (= Y717), H141 (= H718), E208 (= E792), D241 (= D825), V243 (= V827), K244 (≠ Q828), K270 (= K855)
Sites not aligning to the query:
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1zobA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding calcium ion: L76 (≠ T657), S78 (≠ T659), V303 (≠ G887), S304 (≠ G888), D305 (≠ N889)
- binding pyridoxal-5'-phosphate: T108 (≠ S689), A110 (≠ S691), N113 (= N694), W136 (≠ Y717), H137 (= H718), E208 (= E792), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855)
Sites not aligning to the query:
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1zc9A
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G690), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855)
Sites not aligning to the query:
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1m0qA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (≠ V634), T108 (≠ S689), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), S213 (≠ V797), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
Sites not aligning to the query:
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1m0pA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (≠ V634), T108 (≠ S689), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), S213 (≠ V797), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
Sites not aligning to the query:
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1m0oA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (≠ V634), G109 (= G690), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
Sites not aligning to the query:
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1m0nA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (≠ V634), M51 (≠ C635), A110 (≠ S691), N113 (= N694), W136 (≠ Y717), H137 (= H718), E208 (= E792), S213 (≠ V797), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
Sites not aligning to the query:
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1dgdA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding pyridoxal-5'-phosphate: T108 (≠ S689), G109 (= G690), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855)
Sites not aligning to the query:
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1d7vA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding potassium ion: H75 (vs. gap), L76 (≠ T657), F77 (≠ N658), S78 (≠ T659), T301 (= T885), H302 (≠ F886), V303 (≠ G887), S304 (≠ G888), D305 (≠ N889)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), S213 (≠ V797), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
Sites not aligning to the query:
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1d7uA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding potassium ion: H75 (vs. gap), L76 (≠ T657), F77 (≠ N658), S78 (≠ T659), T301 (= T885), H302 (≠ F886), V303 (≠ G887), S304 (≠ G888), D305 (≠ N889)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G690), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
Sites not aligning to the query:
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1d7sA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (≠ V634), G109 (= G690), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
- binding potassium ion: H75 (vs. gap), L76 (≠ T657), F77 (≠ N658), S78 (≠ T659), T301 (= T885), H302 (≠ F886), V303 (≠ G887), S304 (≠ G888), D305 (≠ N889)
Sites not aligning to the query:
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
33% identity, 40% coverage: 607:1009/1017 of query aligns to 23:427/431 of 1d7rA
- active site: W136 (≠ Y717), E208 (= E792), D241 (= D825), Q244 (= Q828), K270 (= K855), T301 (= T885), R404 (≠ K986)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G690), A110 (≠ S691), W136 (≠ Y717), H137 (= H718), E208 (= E792), S213 (≠ V797), D241 (= D825), A243 (≠ V827), Q244 (= Q828), K270 (= K855), R404 (≠ K986)
- binding potassium ion: H75 (vs. gap), L76 (≠ T657), F77 (≠ N658), S78 (≠ T659), T301 (= T885), H302 (≠ F886), V303 (≠ G887), S304 (≠ G888), D305 (≠ N889)
Sites not aligning to the query:
5m49A Alpha-amino epsilon-caprolactam racemase in complex with plp and d/l alpha amino epsilon-caprolactam (internal aldimine)
33% identity, 40% coverage: 608:1009/1017 of query aligns to 21:407/423 of 5m49A
- active site: Y134 (= Y717), E193 (= E792), D226 (= D825), K229 (≠ Q828), K255 (= K855), T283 (= T885), E384 (≠ K986)
- binding (3~{R})-3-azanylazepan-2-one: W47 (vs. gap), Y134 (= Y717), D198 (≠ V797), K229 (≠ Q828), K255 (= K855)
- binding (3~{S})-3-azanylazepan-2-one: W47 (vs. gap), Y134 (= Y717), D198 (≠ V797), K255 (= K855)
- binding pyridoxal-5'-phosphate: S106 (= S689), G107 (= G690), S108 (= S691), Y134 (= Y717), H135 (= H718), D226 (= D825), V228 (= V827), K229 (≠ Q828), K255 (= K855)
Sites not aligning to the query:
O58478 Alanine/serine racemase; ASR; Ala/Ser racemase; EC 5.1.1.-; EC 5.1.1.1 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
28% identity, 41% coverage: 587:1006/1017 of query aligns to 33:455/474 of O58478
- D251 (≠ V797) mutation to A: Loss of activity.
- K308 (= K855) mutation to A: Loss of activity.
Query Sequence
>SMc00677 FitnessBrowser__Smeli:SMc00677
MNDMLKTTPDFTTEEAQALLKQHFGVDGSLQPLDSERDQNFKVNTGEGRCYILKIVNGAE
PEIESDFQTALLKHAGENAGDLPVPHLQPTLSGANLAATTRRGMVHRLRLVTWVPGTPLA
QSDRSDGALHSLGRMLGRFDASLKGFMHPGALRDLDWDIRNAGRSAGRLAHVADLQDRAL
LQRFLDRFDERVAPRLPMLRSAVIHNDANDWNVLIDEDDRDRISGIIDFGDALYAPVIAE
VAIAAAYAGLDHPDPIGAAAAIANGYHAEYPLLEEEVDLLFDLIAMRLVTSVTISASRRA
HTADNPYLAISERPAWALLRKLDAMNPRFATAILRKACGFETVAGAHAVASWIGENRKSL
LPLLDRPAATYPAALVPYGDPTHPMTVSSADGRPHDARSVWEEHCRTTGVELGIGPWGEA
RTVYSGEMFVSRLIEETRRTRHLGLDLFMAAGTKVHTPLAATVASVEIEKDPLGYGCLIA
LRHEPDGCPPFLTLWGHLAHEAVGRLKAGDRLEAGALVGEMGAPEENGGWAPHLHLQIST
DTSLAATDILGVGEERYLDVWAELFPDASTFAGIAREFYDQSGRPHEEIIRRRKELLLPN
LSISYEKPIKFVRGEGVWLIDDRGRAYLDCFNNVCHIGHAHPAVVEALARQAGTLNTNTR
YLHDNIVAYAERLTATMPKELAVAAFANSGSEANSLALRLMRAHTGCENAVVLDWAYHGT
TQELIDLSAYKFRRKGGKGQKPHVHVAAVPDSYHAPAAWPLEEHGKRFAENVAELIAAMR
ARGEAPGFFLAESIPSVAGQVFLPDGYLKEVYRMVREAGGVCIADEVQVGFGRVGSHWWA
FETQGVVPDIVTMGKPIGDGHPLAAVVTTREIAASFDNGMEYFNTFGGNPVSCAVGLAVL
DVIEGEDLRRNALDIGNHLLTAFRTMQERYEVIGDVRGLGLFLGIELVSDRRTRAPATEI
ARAVANGARQRGVLMGTEGPHDNVLKMRPPMIFSKRDADHLIAVLEETFGAVLAQAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory