SitesBLAST
Comparing SMc00680 FitnessBrowser__Smeli:SMc00680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
64% identity, 100% coverage: 1:347/347 of query aligns to 1:349/349 of P0CH37
- K210 (≠ S208) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
64% identity, 100% coverage: 1:347/347 of query aligns to 1:349/349 of P0CH36
- K210 (≠ S208) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
63% identity, 99% coverage: 1:345/347 of query aligns to 1:346/346 of P9WQC5
- K209 (≠ S208) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1yqdA Sinapyl alcohol dehydrogenase complexed with NADP+ (see paper)
51% identity, 98% coverage: 4:342/347 of query aligns to 10:350/359 of 1yqdA
- active site: C47 (= C41), H48 (= H42), S49 (= S43), H52 (= H46), H69 (= H63), E70 (= E64), C100 (= C94), C103 (= C97), C106 (≠ R100), C114 (≠ L108), I118 (≠ V112), C163 (= C157), T167 (= T161), R345 (= R337)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C47 (= C41), H48 (= H42), S49 (= S43), H52 (= H46), C163 (= C157), T167 (= T161), G188 (= G181), L189 (= L182), G190 (= G183), G191 (= G184), L192 (= L185), S211 (= S204), T212 (≠ Q205), S213 (≠ T206), K216 (= K209), T251 (= T243), V252 (= V244), S253 (≠ A245), V274 (= V266), G275 (= G267), A276 (≠ I268), G299 (≠ M291), I300 (= I292), N340 (≠ S332), R345 (= R337)
- binding zinc ion: C47 (= C41), H69 (= H63), C100 (= C94), C103 (= C97), C106 (≠ R100), C114 (≠ L108), C163 (= C157)
1uufA Crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
54% identity, 98% coverage: 5:345/347 of query aligns to 2:338/339 of 1uufA
- active site: C38 (= C41), H39 (= H42), S40 (= S43), H43 (= H46), H60 (= H63), E61 (= E64), C91 (= C94), C94 (= C97), C97 (≠ R100), C105 (≠ L108), T109 (≠ V112), C156 (= C157), T160 (= T161), R330 (= R337)
- binding zinc ion: C38 (= C41), H60 (= H63), C91 (= C94), C94 (= C97), C97 (≠ R100), C105 (≠ L108), C156 (= C157)
Sites not aligning to the query:
6k3gB Crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with NADP+ (see paper)
52% identity, 98% coverage: 4:342/347 of query aligns to 10:350/356 of 6k3gB
- active site: C47 (= C41), S49 (= S43), H52 (= H46), H69 (= H63), C163 (= C157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H48 (= H42), S49 (= S43), H52 (= H46), W58 (= W52), C163 (= C157), T167 (= T161), G188 (= G181), L189 (= L182), G190 (= G183), G191 (= G184), L192 (= L185), S211 (= S204), T212 (≠ Q205), S213 (≠ T206), K216 (= K209), T251 (= T243), V252 (= V244), S253 (≠ A245), A254 (= A246), V274 (= V266), G275 (= G267), A276 (≠ I268), A299 (≠ M291), I300 (= I292), R345 (= R337)
- binding zinc ion: C47 (= C41), H69 (= H63), C100 (= C94), C103 (= C97), C106 (≠ R100), C114 (≠ L108), C163 (= C157)
5z0cA Nerol dehydrogenase from persicaria minor (see paper)
49% identity, 98% coverage: 4:342/347 of query aligns to 7:347/367 of 5z0cA
- active site: C44 (= C41), S46 (= S43), H49 (= H46), H66 (= H63), C160 (= C157)
- binding zinc ion: C44 (= C41), H66 (= H63), C97 (= C94), C100 (= C97), C103 (≠ R100), C111 (≠ L108), C160 (= C157)
5vktA Cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) Moench (see paper)
47% identity, 99% coverage: 4:346/347 of query aligns to 3:349/353 of 5vktA
- active site: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (= H46), H62 (= H63), E63 (= E64), C93 (= C94), C96 (= C97), C99 (≠ R100), C107 (≠ L108), V111 (= V112), C158 (= C157), T162 (= T161), R340 (= R337)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (= H46), C158 (= C157), T162 (= T161), G183 (= G181), L184 (= L182), G185 (= G183), G186 (= G184), L187 (= L185), S206 (= S204), S207 (≠ Q205), S208 (≠ T206), K211 (= K209), T246 (= T243), V247 (= V244), S248 (≠ A245), A249 (= A246), V269 (= V266), G270 (= G267), N293 (≠ S290), G294 (≠ M291), N335 (≠ S332), R340 (= R337)
- binding zinc ion: C40 (= C41), H62 (= H63), C93 (= C94), C96 (= C97), C99 (≠ R100), C107 (≠ L108), C158 (= C157)
7cguA Crystal structure of abhar
48% identity, 98% coverage: 6:344/347 of query aligns to 6:347/352 of 7cguA
3twoB The crystal structure of cad from helicobacter pylori complexed with NADP(h) (see paper)
45% identity, 98% coverage: 4:344/347 of query aligns to 5:345/348 of 3twoB
- active site: C42 (= C41), H43 (= H42), S44 (= S43), H47 (= H46), H64 (= H63), E65 (= E64), C95 (= C94), C98 (= C97), C101 (≠ R100), C109 (≠ L108), V113 (= V112), C160 (= C157), T164 (= T161), R338 (= R337)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: C42 (= C41), H43 (= H42), S44 (= S43), H47 (= H46), C160 (= C157), T164 (= T161), G184 (= G181), F185 (≠ L182), G186 (= G183), G187 (= G184), L188 (= L185), R208 (≠ Q205), T241 (= T243), I242 (≠ V244), P243 (≠ A245), T244 (≠ A246), V264 (= V266), G265 (= G267), L266 (≠ I268), L292 (≠ M291), I293 (= I292), L330 (≠ V329), G333 (≠ S332), R338 (= R337)
- binding zinc ion: C42 (= C41), H64 (= H63), C95 (= C94), C98 (= C97), C101 (≠ R100), C109 (≠ L108), C160 (= C157)
2cf6A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases atcad5 (see paper)
49% identity, 97% coverage: 6:343/347 of query aligns to 7:346/352 of 2cf6A
- active site: C42 (= C41), H43 (= H42), T44 (≠ S43), H47 (= H46), H64 (= H63), E65 (= E64), C95 (= C94), C98 (= C97), C101 (≠ R100), C109 (≠ L108), I113 (≠ V112), C158 (= C157), T162 (= T161), R340 (= R337)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H43 (= H42), T44 (≠ S43), T162 (= T161), L184 (= L182), G185 (= G183), G186 (= G184), V187 (≠ L185), S206 (= S204), S207 (≠ Q205), K211 (= K209), T246 (= T243), M269 (≠ V266), S293 (= S290), F294 (≠ M291), I295 (= I292)
- binding zinc ion: C42 (= C41), H64 (= H63), E65 (= E64), C98 (= C97), C109 (≠ L108)
2cf5A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases, atcad5 (see paper)
49% identity, 97% coverage: 6:343/347 of query aligns to 7:346/352 of 2cf5A
- active site: C42 (= C41), H43 (= H42), T44 (≠ S43), H47 (= H46), H64 (= H63), E65 (= E64), C95 (= C94), C98 (= C97), C101 (≠ R100), C109 (≠ L108), I113 (≠ V112), C158 (= C157), T162 (= T161), R340 (= R337)
- binding zinc ion: C42 (= C41), H64 (= H63), E65 (= E64), C95 (= C94), C98 (= C97), C101 (≠ R100), C109 (≠ L108), C158 (= C157)
O49482 Cinnamyl alcohol dehydrogenase 5; AtCAD5; Cinnamyl alcohol dehydrogenase D; EC 1.1.1.195 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
49% identity, 97% coverage: 6:343/347 of query aligns to 12:351/357 of O49482
- C47 (= C41) binding
- T49 (≠ S43) binding
- H69 (= H63) binding
- E70 (= E64) binding ; mutation to A: Loss of activity.
- C100 (= C94) binding
- C103 (= C97) binding
- C106 (≠ R100) binding
- C114 (≠ L108) binding
- C163 (= C157) binding
- T167 (= T161) binding
- GLGGVG 188:193 (≠ GLGGLG 181:186) binding
- SSSNKK 211:216 (≠ SQTLSK 204:209) binding
- T251 (= T243) binding
- G275 (= G267) binding
- SFI 298:300 (≠ SMI 290:292) binding
Q6ZHS4 Cinnamyl alcohol dehydrogenase 2; OsCAD2; Protein GOLD HULL AND INTERNODE 2; EC 1.1.1.195 from Oryza sativa subsp. japonica (Rice) (see paper)
45% identity, 97% coverage: 6:342/347 of query aligns to 12:350/363 of Q6ZHS4
- G185 (≠ A178) mutation to D: Loss of activity.
5fi3A Heteroyohimbine synthase thas1 from catharanthus roseus - complex with NADP+ (see paper)
43% identity, 98% coverage: 4:342/347 of query aligns to 6:338/344 of 5fi3A
- active site: C43 (= C41), Q44 (≠ H42), Y45 (≠ S43), E48 (≠ H46), H65 (= H63), E66 (= E64), C96 (= C94), C99 (= C97), C102 (≠ R100), C110 (≠ L108), G114 (≠ D121), C151 (= C157), R333 (= R337)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Q44 (≠ H42), E48 (≠ H46), T155 (= T161), G176 (= G181), L177 (= L182), G178 (= G183), G179 (= G184), L180 (= L185), S199 (= S204), S200 (≠ Q205), K204 (= K209), T239 (= T243), I240 (≠ V244), P241 (≠ A245), L262 (≠ V266), G263 (= G267), T287 (≠ M291), S328 (= S332)
- binding zinc ion: C43 (= C41), H65 (= H63), E66 (= E64), C96 (= C94), C99 (= C97), C102 (≠ R100), C110 (≠ L108), C151 (= C157)
8b1vA Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga (see paper)
44% identity, 98% coverage: 4:344/347 of query aligns to 10:353/358 of 8b1vA
8b25B Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga - stemmadenine acetate bound structure (see paper)
44% identity, 98% coverage: 4:344/347 of query aligns to 10:353/359 of 8b25B
5h81B Heteroyohimbine synthase thas2 from catharanthus roseus - complex with NADP+ (see paper)
41% identity, 98% coverage: 4:344/347 of query aligns to 4:350/354 of 5h81B
- active site: A343 (≠ R337)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V174 (≠ T161), F196 (≠ L182), G197 (= G183), R198 (≠ G184), I199 (≠ L185), S218 (= S204), T219 (≠ Q205), S220 (≠ T206), K223 (= K209), V259 (= V244), P260 (≠ A245), L281 (≠ V266), I297 (≠ M291)
- binding zinc ion: C41 (= C41), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (≠ R100), C108 (≠ L108), C170 (= C157)
8a3nB Geissoschizine synthase from catharanthus roseus - binary complex with NADP+ (see paper)
42% identity, 98% coverage: 4:342/347 of query aligns to 7:345/352 of 8a3nB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N45 (≠ H42), V161 (≠ T161), G182 (= G181), L183 (= L182), L186 (= L185), S205 (= S204), T206 (≠ Q205), K210 (= K209), T245 (≠ C242), P247 (≠ V244), V269 (= V266), A271 (≠ I268), S294 (≠ M291), L335 (≠ S332), R340 (= R337)
- binding zinc ion: C44 (= C41), H66 (= H63), E67 (= E64), C97 (= C94), C100 (= C97), C103 (≠ R100), C111 (≠ L108), C157 (= C157)
5h83A Heteroyohimbine synthase hys from catharanthus roseus - apo form (see paper)
42% identity, 97% coverage: 6:342/347 of query aligns to 13:347/354 of 5h83A
Query Sequence
>SMc00680 FitnessBrowser__Smeli:SMc00680
MAIARGYAATDASKPLAPFTFERREPRDDDVVIDIKYCGVCHSDIHQARDEWGNSTFPMV
PGHEIVGIVRAVGSQVTRFKIGDRVGVGCFVDSCTTCAKRDLDLEQYLPGLVVTYNGVEA
DGTPTQGGYSDHIVVKEGYVLSIPENLPLDAAAPLLCAGITLYSPLRHWKAGPGKKVAIV
GLGGLGHMGVKLAHAMGAEVTVLSQTLSKKEDGLKLGADHYYATKDPETFTKLAGSFDLI
ICTVAAEIDWNAYLNLLKVDGELVLVGIPENPVPVHAFSLVPARRSISGSMIGSIKETQE
MLDFCGEHGIVSEIETIRMEQINEAYERVVRSDVRYRFVIDMESIKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory