Comparing SMc00682 FitnessBrowser__Smeli:SMc00682 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
40% identity, 94% coverage: 18:381/387 of query aligns to 14:372/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 97% coverage: 11:385/387 of query aligns to 41:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 96% coverage: 13:385/387 of query aligns to 47:427/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
36% identity, 93% coverage: 13:370/387 of query aligns to 15:373/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
33% identity, 87% coverage: 3:339/387 of query aligns to 8:344/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
25% identity, 71% coverage: 3:278/387 of query aligns to 7:261/391 of 3ramA
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
22% identity, 84% coverage: 16:339/387 of query aligns to 7:331/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
22% identity, 84% coverage: 16:339/387 of query aligns to 7:331/376 of 4o23A
>SMc00682 FitnessBrowser__Smeli:SMc00682
MPILNRAAELKNEVTEWRRHLHQNPELLFAVENTAAFVERKLREFGVDEIVTGLGRTGVV
GLIRGNRGPGRTVGLRADMDALPITEASGRAWSSTAPGKMHACGHDGHTAMLLGAAKYLS
ETRNFAGNVAVIFQPAEEGGGGGNEMVKDGMMERFAIEEVYGMHNMPGMPVGHFGSRAGP
IMASTDEFNITVKGRGGHAAQPHKTIDPIAIGAQIVNALQTIASRTVDPLASIVVSVTKF
NAGFAHNVIPEQAVLAGTVRALTPEVRDTGEARIRQIAENIAGAYGATVDVWYGRNYPVT
VNHAAEAGHALAVAATIAGEGNVNAALDPMMGGEDFSYMLLARPGAFVFIGNGDTAGLHH
PAYDFNDEAIPHGISYWVKLAETRLAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory