SitesBLAST
Comparing SMc00696 FitnessBrowser__Smeli:SMc00696 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
46% identity, 95% coverage: 11:367/377 of query aligns to 2:351/361 of Q9KNV2
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
45% identity, 93% coverage: 2:352/377 of query aligns to 65:419/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
46% identity, 90% coverage: 13:352/377 of query aligns to 4:339/365 of 3zokA
- active site: R122 (= R130), K144 (= K152), E186 (= E194), K228 (= K235), E238 (= E245), R242 (= R249), N246 (= N253), H249 (= H256), H253 (= H260), H266 (= H275)
- binding glycine: K144 (= K152), K228 (= K235), R242 (= R249)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ N54), V45 (= V55), D73 (≠ A81), E75 (= E83), K78 (= K86), G106 (= G114), G107 (= G115), V108 (= V116), D111 (= D119), T131 (= T139), T132 (≠ S140), M134 (≠ L142), D138 (= D146), S139 (= S147), K144 (= K152), K153 (= K161), T174 (= T182), L175 (= L183), E179 (= E187), H266 (= H275)
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
46% identity, 95% coverage: 8:367/377 of query aligns to 1:350/360 of 3okfA
- active site: R120 (= R130), K142 (= K152), E184 (= E194), K226 (= K235), R238 (= R249), N242 (= N253), H245 (= H256), H249 (= H260), H262 (= H275)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D52), L48 (≠ R58), D71 (≠ A81), E73 (= E83), K76 (= K86), G104 (= G114), G105 (= G115), V106 (= V116), D109 (= D119), T129 (= T139), T130 (≠ S140), L132 (= L142), D136 (= D146), T172 (= T182), L173 (= L183), E177 (= E187)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
43% identity, 93% coverage: 11:361/377 of query aligns to 3:339/355 of 5eksA
- active site: R120 (= R130), K142 (= K152), E184 (= E194), K226 (= K235), R237 (= R249), N241 (= N253), H244 (= H256), H248 (= H260), H261 (= H275)
- binding magnesium ion: E184 (= E194), H244 (= H256), H261 (= H275)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D52), V45 (= V55), D71 (≠ A81), E73 (= E83), K76 (= K86), G104 (= G114), G105 (= G115), V106 (= V116), D109 (= D119), T129 (= T139), T130 (≠ S140), D136 (= D146), S137 (= S147), K142 (= K152), T172 (= T182), L173 (= L183), E177 (= E187)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
46% identity, 97% coverage: 11:376/377 of query aligns to 3:363/363 of 6llaB
- active site: R121 (= R130), K143 (= K152), E185 (= E194), K227 (= K235), E237 (= E245), R242 (= R249), N246 (= N253), H249 (= H256), H253 (= H260), H266 (= H275)
- binding magnesium ion: E185 (= E194), H249 (= H256), H266 (= H275)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V55), D72 (≠ A81), E74 (= E83), K77 (= K86), G105 (= G114), G106 (= G115), V107 (= V116), D110 (= D119), T130 (= T139), T131 (≠ S140), L133 (= L142), D137 (= D146), K143 (= K152), T173 (= T182), L174 (= L183), E178 (= E187)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
47% identity, 95% coverage: 11:367/377 of query aligns to 3:350/357 of 6lk2A
- active site: R121 (= R130), K143 (= K152), E185 (= E194), K227 (= K235), R238 (= R249), N242 (= N253), H245 (= H256), H249 (= H260), H262 (= H275)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D146), E185 (= E194), K227 (= K235), R238 (= R249), N242 (= N253), H245 (= H256), T246 (= T257), H249 (= H260), H262 (= H275)
- binding magnesium ion: E185 (= E194), H245 (= H256), H262 (= H275)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V55), D72 (≠ A81), E74 (= E83), K77 (= K86), G105 (= G114), G106 (= G115), V107 (= V116), D110 (= D119), T130 (= T139), T131 (≠ S140), L133 (= L142), D137 (= D146), S138 (= S147), C170 (≠ A179), T173 (= T182), L174 (= L183), P175 (≠ S184), E178 (= E187)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
42% identity, 89% coverage: 21:354/377 of query aligns to 14:339/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
41% identity, 89% coverage: 21:354/377 of query aligns to 17:334/354 of 5hvnA
- active site: R123 (= R130), K145 (= K152), E187 (= E194), K228 (= K235), R239 (= R249), N243 (= N253), H246 (= H256), H250 (= H260), H263 (= H275)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D52), L51 (≠ R58), D73 (≠ A81), E75 (= E83), K78 (= K86), G107 (= G114), G108 (= G115), V109 (= V116), D112 (= D119), T132 (= T139), T133 (≠ S140), L135 (= L142), D139 (= D146), K145 (= K152), F172 (≠ A179), T175 (= T182), L176 (= L183), E180 (= E187)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
38% identity, 97% coverage: 11:375/377 of query aligns to 2:343/343 of P56081
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
38% identity, 92% coverage: 23:369/377 of query aligns to 12:385/1555 of 6hqvA
- active site: R123 (= R130), K145 (= K152), E187 (= E194), K243 (= K235), E253 (= E245), R257 (= R249), N261 (= N253), H264 (= H256), H268 (= H260), H280 (= H275)
- binding glutamic acid: D139 (= D146), K145 (= K152), E187 (= E194), K243 (= K235), R257 (= R249), H264 (= H256), H280 (= H275)
- binding nicotinamide-adenine-dinucleotide: D42 (= D52), N44 (= N54), L45 (≠ V55), E76 (= E83), K79 (= K86), G107 (= G114), G108 (= G115), V109 (= V116), D112 (= D119), T132 (= T139), T133 (≠ S140), L135 (= L142), D139 (= D146), S140 (= S147), K145 (= K152), K154 (= K161), T175 (= T182), L176 (= L183), P177 (≠ S184), E180 (= E187), H280 (= H275)
- binding zinc ion: E187 (= E194), H264 (= H256), H280 (= H275)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
36% identity, 96% coverage: 13:375/377 of query aligns to 1:308/308 of 3clhA
- active site: R107 (= R130), K129 (= K152), E171 (= E194), K207 (= K235), R212 (= R249), N216 (= N253), H219 (= H256), H223 (= H260), H236 (= H275)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ N54), V34 (= V55), H38 (≠ Y59), S58 (≠ A81), E60 (= E83), K63 (= K86), G91 (= G114), G92 (= G115), V93 (= V116), D96 (= D119), T116 (= T139), T117 (≠ S140), L119 (= L142), D123 (= D146), A124 (≠ S147), K129 (= K152), N139 (= N162), T159 (= T182), L160 (= L183), E164 (= E187)
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
39% identity, 85% coverage: 36:357/377 of query aligns to 25:365/381 of 1dqsA
- active site: R127 (= R130), K149 (= K152), E191 (= E194), K240 (= K235), E250 (= E245), R254 (= R249), N258 (= N253), H261 (= H256), H265 (= H260), H277 (= H275)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D146), K149 (= K152), N159 (= N162), E191 (= E194), K240 (= K235), R254 (= R249), L257 (= L252), N258 (= N253), H261 (= H256), H265 (= H260), H277 (= H275), K346 (= K338)
- binding nicotinamide-adenine-dinucleotide: D41 (= D52), N43 (= N54), I44 (≠ V55), E78 (= E83), K81 (= K86), G111 (= G114), G112 (= G115), V113 (= V116), D116 (= D119), T136 (= T139), T137 (≠ S140), L139 (= L142), D143 (= D146), S144 (= S147), K158 (= K161), T179 (= T182), P181 (≠ S184), E184 (= E187), H277 (= H275)
- binding zinc ion: E191 (= E194), H261 (= H256), H277 (= H275)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
38% identity, 85% coverage: 36:357/377 of query aligns to 28:375/1583 of P07547
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
38% identity, 85% coverage: 36:357/377 of query aligns to 26:373/391 of 1nvbB
- active site: R128 (= R130), K150 (= K152), E192 (= E194), K248 (= K235), E258 (= E245), R262 (= R249), N266 (= N253), H269 (= H256), H273 (= H260), H285 (= H275)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D146), K150 (= K152), N160 (= N162), E192 (= E194), K248 (= K235), R262 (= R249), L265 (= L252), N266 (= N253), H269 (= H256), H273 (= H260), K354 (= K338)
- binding zinc ion: E192 (= E194), H269 (= H256), H285 (= H275)
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
34% identity, 91% coverage: 12:354/377 of query aligns to 2:330/354 of Q6GGU4
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
38% identity, 89% coverage: 22:355/377 of query aligns to 18:340/362 of P9WPX9
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
34% identity, 91% coverage: 12:354/377 of query aligns to 2:330/353 of 1xagA
- active site: R115 (= R130), K136 (= K152), E178 (= E194), K221 (= K235), E231 (= E245), R235 (= R249), N239 (= N253), H242 (= H256), H246 (= H260), H256 (= H275)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K152), N146 (= N162), E178 (= E194), K221 (= K235), R235 (= R249), L238 (= L252), N239 (= N253), H242 (= H256), H246 (= H260), K314 (= K338)
- binding nicotinamide-adenine-dinucleotide: D39 (= D52), Y41 (≠ N54), V42 (= V55), Y45 (≠ R58), E68 (= E83), K71 (= K86), G99 (= G114), G100 (= G115), A101 (≠ V116), D104 (= D119), T124 (= T139), T125 (≠ S140), L127 (= L142), D130 (= D146), S131 (= S147), K136 (= K152), K145 (= K161), T166 (= T182), L167 (= L183), Q171 (≠ E187), H256 (= H275)
- binding zinc ion: E178 (= E194), H242 (= H256), H256 (= H275)
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
35% identity, 89% coverage: 24:357/377 of query aligns to 17:368/385 of 6c5cA
- active site: R130 (= R130), K152 (= K152), E194 (= E194), K246 (= K235), E254 (= E243), R258 (= R249), N262 (= N253), H265 (= H256), H269 (= H260), H281 (= H275)
- binding nicotinamide-adenine-dinucleotide: D45 (= D52), N47 (= N54), M48 (≠ V55), E83 (= E83), K86 (= K86), G114 (= G114), G115 (= G115), V116 (= V116), D119 (= D119), T139 (= T139), T140 (≠ S140), D146 (= D146), S147 (= S147), F179 (≠ A179), T182 (= T182), L183 (= L183), Q187 (≠ E187)
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
37% identity, 89% coverage: 22:355/377 of query aligns to 13:331/352 of 3qbeA
- active site: R117 (= R130), K139 (= K152), E181 (= E194), K223 (= K235), R233 (= R249), N237 (= N253), H240 (= H256), H244 (= H260), H256 (= H275)
- binding zinc ion: E181 (= E194), H240 (= H256), H256 (= H275)
Query Sequence
>SMc00696 FitnessBrowser__Smeli:SMc00696
MTSHVMPTAERKVRVDLAERSYDILIGPGLIAAAGKEIASRLKGRKMAVITDENVAPRYL
EPLMASLGESGIEAVSLILPAGEKTKSFEHLIPVCEAILGARIERNDAVIALGGGVIGDL
TGFAAGIVRRGSRFIQIPTSLLAQVDSSVGGKTGINSAHGKNLIGVFHQPDLVLADTAAL
DTLSPREFRAGYAEVAKYGLIDKPEFFEWLEKNWQAVFAGGPARIEAIAVSCQAKADVVA
ADERENGRRALLNLGHTFGHALEAATDYDSKRLVHGEGVAIGMVLAHEFSARMNLASPDD
ARRVEAHLKTVGLPTRLADIPGALPPADRLMEAIAQDKKVKGGKLTFILTRGIGQSFVAD
DVPSSEVLSFLTEKHPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory