Comparing SMc00710 FitnessBrowser__Smeli:SMc00710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
32% identity, 93% coverage: 24:365/368 of query aligns to 26:365/369 of 4wbtA
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
34% identity, 93% coverage: 11:354/368 of query aligns to 6:339/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
34% identity, 93% coverage: 11:354/368 of query aligns to 6:339/353 of 4r2nA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
28% identity, 90% coverage: 35:364/368 of query aligns to 36:359/360 of 8bj3A
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
26% identity, 93% coverage: 27:367/368 of query aligns to 12:351/354 of 3ly1D
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
29% identity, 93% coverage: 25:365/368 of query aligns to 18:362/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
29% identity, 93% coverage: 25:365/368 of query aligns to 16:360/364 of 3cq6A
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
32% identity, 91% coverage: 27:360/368 of query aligns to 23:357/369 of 4r8dA
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
29% identity, 89% coverage: 36:362/368 of query aligns to 32:350/353 of 7szpA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
28% identity, 92% coverage: 23:361/368 of query aligns to 6:335/335 of 1geyA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
28% identity, 86% coverage: 47:361/368 of query aligns to 38:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
28% identity, 86% coverage: 47:361/368 of query aligns to 38:349/354 of 1fg3A
Sites not aligning to the query:
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
26% identity, 89% coverage: 36:364/368 of query aligns to 25:335/335 of 2f8jA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 89% coverage: 36:364/368 of query aligns to 18:328/328 of 1uu0A
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 89% coverage: 36:364/368 of query aligns to 24:334/335 of Q9X0D0
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 89% coverage: 36:364/368 of query aligns to 19:329/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
26% identity, 89% coverage: 36:364/368 of query aligns to 19:329/329 of 1h1cA
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
27% identity, 91% coverage: 32:365/368 of query aligns to 19:351/356 of 1lc8A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
27% identity, 91% coverage: 32:365/368 of query aligns to 18:350/355 of 1lkcA
Sites not aligning to the query:
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
25% identity, 48% coverage: 72:246/368 of query aligns to 95:264/402 of P14909
Sites not aligning to the query:
>SMc00710 FitnessBrowser__Smeli:SMc00710
MNLALKSPAPRSGILDIAAYVPGKEHAPGVAKVHKLSSNETPLGASPRAIEAFQKAAFNL
ERYPDGQANALKEAIAAVHGLNPANILCGNGSDELLGLLCHTYLGPGDEGIVTEHGFLVY
KIQITASGGTPVTVKERQERVDVDAILAAVTERTKIVFIANPANPTGTYIPVEEVRRLHA
GLPAGVLLVLDAAYAEYVRRNDYEAGLELVSSNRNVVMTRTFSKIYGLAGLRIGWMYAPR
DVVEALDRVRGPFNLNAAAIAAGAAAIRDQAFVAAAVDQNHTWLAKIGQALTDIGLRVTP
SVTNFVLIHFPEEAGMSASDADAYLTSRGFILRAVGAYGFPNALRMTIGSEEANKGVVAA
LTEFMGRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory