SitesBLAST
Comparing SMc00735 FitnessBrowser__Smeli:SMc00735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
40% identity, 95% coverage: 12:295/298 of query aligns to 5:276/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
40% identity, 95% coverage: 12:295/298 of query aligns to 6:277/485 of Q8DLI5
- R6 (= R12) binding
- Y192 (= Y211) binding
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
34% identity, 95% coverage: 10:291/298 of query aligns to 3:267/468 of 1g59A
- binding : D44 (= D51), R45 (= R52), A46 (≠ T53), R47 (= R54), P109 (≠ R108), V145 (≠ A158), R163 (≠ S189), V166 (≠ I190), E172 (≠ A196), V177 (≠ I201), K180 (≠ R204), S181 (= S205), D182 (= D206), E207 (≠ R231), E208 (≠ D232), R237 (≠ L261), K241 (≠ G265), T242 (≠ R266), K243 (= K267)
Sites not aligning to the query:
- binding : 273, 274, 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
33% identity, 95% coverage: 10:291/298 of query aligns to 3:267/468 of 2cv2A
- active site: K246 (= K270)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R12), A7 (= A14), S9 (= S16), G17 (= G24), I21 (≠ S28), E41 (= E48), Y187 (= Y211), R205 (= R229), A206 (≠ G230), E208 (≠ D232), W209 (≠ L233), L235 (= L259), L236 (≠ V260)
- binding : S9 (= S16), T43 (≠ I50), D44 (= D51), R47 (= R54), V145 (≠ A158), R163 (≠ S189), Y168 (≠ A192), E172 (≠ A196), V177 (≠ I201), K180 (≠ R204), S181 (= S205), Y187 (= Y211), E207 (≠ R231), E208 (≠ D232), W209 (≠ L233), V211 (≠ H235), R237 (≠ L261), K241 (≠ G265)
Sites not aligning to the query:
- binding : 272, 273, 274, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
33% identity, 95% coverage: 10:291/298 of query aligns to 3:267/468 of 2cv1A
- active site: K246 (= K270)
- binding adenosine-5'-triphosphate: P8 (= P15), S9 (= S16), G17 (= G24), T18 (≠ H25), I21 (≠ S28), R47 (= R54), A206 (≠ G230), W209 (≠ L233), L235 (= L259), L236 (≠ V260)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R12), A7 (= A14), E41 (= E48), Y187 (= Y211), R205 (= R229), W209 (≠ L233)
- binding : S9 (= S16), E41 (= E48), T43 (≠ I50), D44 (= D51), R47 (= R54), V145 (≠ A158), R163 (≠ S189), V166 (≠ I190), E172 (≠ A196), V177 (≠ I201), K180 (≠ R204), S181 (= S205), Y187 (= Y211), E207 (≠ R231), E208 (≠ D232), W209 (≠ L233), V211 (≠ H235), R237 (≠ L261), K241 (≠ G265), K243 (= K267)
Sites not aligning to the query:
- binding : 273, 274, 276, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l- glutamate (see paper)
33% identity, 95% coverage: 10:291/298 of query aligns to 3:267/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
33% identity, 95% coverage: 10:291/298 of query aligns to 3:267/468 of 1n78A
- active site: K246 (= K270)
- binding glutamol-amp: R5 (= R12), A7 (= A14), P8 (= P15), S9 (= S16), G17 (= G24), T18 (≠ H25), I21 (≠ S28), E41 (= E48), Y187 (= Y211), N191 (≠ V215), R205 (= R229), A206 (≠ G230), E208 (≠ D232), W209 (≠ L233), L235 (= L259), L236 (≠ V260)
- binding : S9 (= S16), T43 (≠ I50), D44 (= D51), R47 (= R54), V145 (≠ A158), R163 (≠ S189), V166 (≠ I190), Y168 (≠ A192), E172 (≠ A196), V177 (≠ I201), K180 (≠ R204), S181 (= S205), Y187 (= Y211), E207 (≠ R231), E208 (≠ D232), W209 (≠ L233), L210 (≠ Y234), V211 (≠ H235), R237 (≠ L261), K241 (≠ G265)
Sites not aligning to the query:
- binding : 273, 274, 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
33% identity, 95% coverage: 10:291/298 of query aligns to 3:267/468 of 1j09A
- active site: K246 (= K270)
- binding adenosine-5'-triphosphate: H15 (= H22), E208 (≠ D232), L235 (= L259), L236 (≠ V260), K243 (= K267), I244 (≠ L268), S245 (= S269), K246 (= K270), R247 (≠ S271)
- binding glutamic acid: R5 (= R12), A7 (= A14), S9 (= S16), E41 (= E48), Y187 (= Y211), N191 (≠ V215), R205 (= R229), W209 (≠ L233)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 95% coverage: 10:291/298 of query aligns to 3:267/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 93% coverage: 12:287/298 of query aligns to 6:257/471 of P04805
- C98 (≠ A104) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ M106) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ E139) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (vs. gap) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (vs. gap) mutation to Q: No change in activity or in zinc content.
- H131 (≠ F142) mutation to Q: No change in activity or in zinc content.
- H132 (≠ T143) mutation to Q: No change in activity or in zinc content.
- C138 (≠ A149) mutation to S: No change in activity or in zinc content.
- S239 (= S269) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
30% identity, 93% coverage: 12:287/298 of query aligns to 6:257/468 of 8i9iA
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
31% identity, 95% coverage: 12:294/298 of query aligns to 5:277/485 of 4griB
- active site: S9 (= S16), K253 (= K270)
- binding glutamic acid: R5 (= R12), A7 (= A14), S9 (= S16), E41 (= E48), Y194 (= Y211), R212 (= R229), W216 (≠ L233)
- binding zinc ion: C105 (≠ A104), C107 (≠ M106), Y128 (= Y135), C132 (≠ E139)
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
33% identity, 94% coverage: 12:290/298 of query aligns to 6:245/380 of 4g6zA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
31% identity, 92% coverage: 12:284/298 of query aligns to 106:349/564 of 3al0C
- active site: S110 (= S16), K335 (= K270)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R12), A108 (= A14), P109 (= P15), G118 (= G24), T122 (≠ S28), E142 (= E48), Y276 (= Y211), R294 (= R229), G295 (= G230), D297 (= D232), H298 (≠ L233), L324 (= L259), I325 (≠ V260), L333 (= L268)
- binding : T144 (≠ I50), D145 (= D51), R148 (= R54), Y208 (≠ M106), P213 (= P136), K252 (≠ A192), M255 (vs. gap), I266 (= I201), K269 (≠ R204), S270 (= S205), Y276 (= Y211), D297 (= D232), H298 (≠ L233), L299 (≠ Y234), S300 (≠ H235), N301 (≠ A236), K304 (≠ V239), R330 (≠ G265), P332 (≠ K267)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 89% coverage: 8:272/298 of query aligns to 15:243/308 of P27305
- E55 (= E48) binding
- Y182 (= Y211) binding
- R200 (= R229) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
33% identity, 89% coverage: 8:271/298 of query aligns to 3:230/290 of 4a91A
- active site: S11 (= S16), K229 (= K270)
- binding glutamic acid: R7 (= R12), A9 (= A14), S11 (= S16), E43 (= E48), Y170 (= Y211), R188 (= R229), L192 (= L233)
- binding zinc ion: C99 (≠ A104), C101 (≠ M106), Y113 (= Y135), C117 (≠ E139)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
30% identity, 93% coverage: 12:287/298 of query aligns to 7:271/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
32% identity, 88% coverage: 12:274/298 of query aligns to 6:265/502 of 6brlA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
31% identity, 74% coverage: 10:229/298 of query aligns to 12:206/455 of 3aiiA
Sites not aligning to the query:
2re8A Glutaminyl-tRNA synthetase mutant c229r with bound analog 5'-o-[n-(l- glutamyl)-sulfamoyl]adenosine (see paper)
27% identity, 73% coverage: 12:229/298 of query aligns to 23:222/529 of 2re8A
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: P25 (≠ A14), P26 (= P15), E27 (≠ S16), G35 (= G24), H36 (= H25), D59 (≠ E48), Y204 (= Y211), H208 (≠ V215), R222 (= R229)
- binding : E27 (≠ S16), T61 (≠ I50), N62 (≠ D51), L117 (≠ M106), P119 (≠ R108), R123 (= R112), R126 (≠ V115), T128 (≠ A117), L129 (≠ A118), G161 (≠ E146), P174 (≠ A166), F175 (≠ V167), I176 (≠ R168), V182 (≠ L174), R185 (= R177), M203 (≠ A195), Y204 (= Y211)
Sites not aligning to the query:
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: 223, 253, 254, 263
- binding : 6, 226, 228, 306, 309, 310, 311, 313, 314, 316, 319, 322, 329, 334, 362, 363, 392, 394, 395, 403, 405, 406, 435, 499, 501, 502, 527
Query Sequence
>SMc00735 FitnessBrowser__Smeli:SMc00735
MPISRPEQPVFRFAPSPNGLLHLGHALSAILNHDMAAAMGGRFLLRIEDIDRTRCRPEFE
AAIFEDLAWLGLDWEEPVRRQSEHLGVYAAALERLKAMGLVYPAVMTRGEIRAAVAAAEA
KGQAWPRDPDGTPLYPGRERGFTPDEQAALLASGRPYAWRLDMGEAVRCAGEPLTWRETG
LSQSGEATSIVADPAAWGDVILSRSDAPSSYHLSVVVDDALQGITHVVRGRDLYHATSVH
RLLQRLLDLPQPVYHHHRLVLGPDGRKLSKSDSDTGIAAFRAAGHRPADVRAMVLGER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory