SitesBLAST
Comparing SMc00761 FitnessBrowser__Smeli:SMc00761 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 86% coverage: 32:399/428 of query aligns to 1:356/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I38), G8 (= G39), G10 (= G41), V11 (≠ Y42), I12 (≠ T43), V30 (≠ I61), E31 (≠ D62), K32 (≠ A63), E38 (≠ G69), A39 (= A70), S40 (= S71), A43 (≠ N74), G45 (= G76), L46 (≠ Q77), V171 (≠ A213), G200 (≠ C241), G201 (≠ N242), W203 (≠ Y244), G298 (= G342), R300 (≠ V344), P301 (≠ G345), Y326 (≠ S368), R327 (≠ G369), N328 (≠ H370), G329 (= G371), I330 (≠ V372)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 50% coverage: 186:400/428 of query aligns to 147:360/369 of S5FMM4
- S202 (≠ C241) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V372) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ Y382) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
Query Sequence
>SMc00761 FitnessBrowser__Smeli:SMc00761
MTWQSPISPGYSWYEATIPERPVFPIMPGSRKADVAIIGGGYTGLQAACNLARSGTDVTL
IDACRFGDGASGRNGGQFGTGQRVWADETEEVLGREWAQRLFDMAENAKRYVLGFAEEHA
IDIEFMPGQLSVGHKASLERDYRNHVEAMTGRYGYPHLSFMDREETVSRLGSSHYHFGIR
DTGTGHIHPMKLVVGLARQAALAGANLYEGTKALKIEKKGGAVVIETTSGTITADRALIA
CNGYIGNLEPVTASHVMPIRSFIGATTVLHGHPEILPGGESVDDSRFVVRYFRKSKDGRL
LFGGREAYTADNPRDISAHIRRQICEIYPDLADVEITHAWGGSVGITMPRQPFCREVMPG
VTTIGGYSGHGVMLANYCGKLYAELALGKSTELDLLKQLKIPAFPGGTRFRSALLFLALS
WYALRDRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory