SitesBLAST
Comparing SMc00778 FitnessBrowser__Smeli:SMc00778 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 100% coverage: 1:254/255 of query aligns to 1:254/255 of 5itvA
- active site: G18 (= G18), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ G17), G18 (= G18), I19 (≠ C19), D38 (= D38), I39 (≠ L39), T61 (≠ A63), I63 (≠ A65), N89 (≠ H91), G91 (= G93), T139 (= T141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I186 (≠ F188), I187 (= I189)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 100% coverage: 1:254/255 of query aligns to 1:226/227 of 5itvD
- active site: G18 (= G18), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ G17), G18 (= G18), I19 (≠ C19), D38 (= D38), I39 (≠ L39), T61 (≠ A63), D62 (= D64), I63 (≠ A65), N89 (≠ H91), T139 (= T141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I187 (= I189)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 99% coverage: 3:255/255 of query aligns to 1:248/248 of 6ixmC
- active site: G16 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ G17), G16 (= G18), I17 (≠ C19), D36 (= D38), I37 (≠ L39), A61 (= A63), D62 (= D64), T63 (≠ A65), N89 (≠ H91), A90 (= A92), M140 (≠ T141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), Y187 (≠ F188), I188 (= I189), L192 (≠ H193)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
33% identity, 100% coverage: 1:254/255 of query aligns to 1:251/252 of Q6WVP7
Sites not aligning to the query:
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
36% identity, 98% coverage: 4:253/255 of query aligns to 3:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S143), H147 (≠ E153), Y150 (= Y156), L188 (vs. gap), L246 (≠ F252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ A16), S16 (≠ G17), G17 (= G18), I18 (≠ C19), R38 (≠ L39), R39 (≠ P40), D60 (= D64), V61 (≠ A65), N87 (≠ H91), S88 (≠ A92), G89 (= G93), V110 (= V114), T135 (= T141), S137 (= S143), Y150 (= Y156), K154 (= K160), P180 (= P186), G181 (= G187), A182 (≠ F188), I183 (= I189), T185 (= T191), S187 (vs. gap)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
33% identity, 100% coverage: 1:254/255 of query aligns to 2:252/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S143), I145 (= I144), E146 (≠ S145), Y157 (= Y156), V197 (vs. gap), F207 (≠ V198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), T17 (≠ A16), I20 (≠ C19), R40 (≠ L39), H41 (≠ P40), D64 (= D64), A65 (= A65), N91 (≠ H91), A92 (= A92), V114 (= V114), M142 (≠ T141), S144 (= S143), Y157 (= Y156), K161 (= K160), P189 (= P186), G190 (= G187), P191 (≠ F188), I192 (= I189), T194 (= T191), P195 (vs. gap), L196 (vs. gap)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
36% identity, 97% coverage: 8:255/255 of query aligns to 3:250/250 of 2cfcA
- active site: G13 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ T150), R152 (≠ E153), Y155 (= Y156), W195 (≠ R196), R196 (≠ E197)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), S12 (≠ G17), G13 (= G18), N14 (≠ C19), D33 (= D38), L34 (= L39), A59 (= A63), D60 (= D64), V61 (≠ A65), N87 (≠ H91), A88 (= A92), G89 (= G93), I140 (≠ T141), P185 (= P186), G186 (= G187), M187 (≠ F188), I188 (= I189), T190 (= T191), P191 (≠ A192), M192 (≠ H193), T193 (≠ G194)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
36% identity, 97% coverage: 8:255/255 of query aligns to 3:250/250 of Q56840
- SGN 12:14 (≠ GGC 17:19) binding
- D33 (= D38) binding
- DV 60:61 (≠ DA 64:65) binding
- N87 (≠ H91) binding
- S142 (= S143) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ E153) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y156) mutation Y->E,F: Loss of activity.
- K159 (= K160) mutation to A: Loss of activity.
- R179 (= R180) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IQTAH 189:193) binding
- WR 195:196 (≠ RE 196:197) binding
- R196 (≠ E197) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ S209) mutation to A: Slight decrease in catalytic efficiency.
- R209 (vs. gap) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
34% identity, 99% coverage: 2:254/255 of query aligns to 1:250/251 of 1zk1A
- active site: G17 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding 1-phenylethanone: A93 (≠ I95), N95 (≠ I97), Y155 (= Y156), Y189 (≠ F188)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), L16 (≠ G17), I18 (≠ C19), D37 (= D38), H61 (≠ A63), D62 (= D64), S63 (≠ A65), N89 (≠ H91), A90 (= A92), I92 (≠ T94), M140 (≠ T141), Y155 (= Y156), G188 (= G187), I190 (= I189), L194 (≠ H193)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
34% identity, 99% coverage: 2:254/255 of query aligns to 1:250/251 of 1zjzA
- active site: G17 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), L16 (≠ G17), I18 (≠ C19), D37 (= D38), D62 (= D64), N89 (≠ H91), A90 (= A92), G91 (= G93), I92 (≠ T94), Y155 (= Y156), G188 (= G187), I190 (= I189), L194 (≠ H193)
- binding (1r)-1-phenylethanol: A93 (≠ I95), N95 (≠ I97), L152 (≠ E153), Y155 (= Y156)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
34% identity, 99% coverage: 2:254/255 of query aligns to 1:250/251 of 1zjyA
- active site: G17 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G14), L16 (≠ G17), G17 (= G18), I18 (≠ C19), D37 (= D38), D62 (= D64), N89 (≠ H91), A90 (= A92), G91 (= G93), I92 (≠ T94), Y155 (= Y156), G188 (= G187), I190 (= I189), L194 (≠ H193)
- binding (1r)-1-phenylethanol: A93 (≠ I95), N95 (≠ I97), L152 (≠ E153), Y155 (= Y156), Y189 (≠ F188)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
34% identity, 98% coverage: 4:254/255 of query aligns to 3:250/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S143), I143 (= I144), Y155 (= Y156), F205 (≠ V198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (≠ A16), L16 (≠ G17), G17 (= G18), I18 (≠ C19), R38 (≠ L39), H39 (≠ P40), D62 (= D64), A63 (= A65), N89 (≠ H91), A90 (= A92), V112 (= V114), M140 (≠ T141), S142 (= S143), Y155 (= Y156), K159 (= K160), P187 (= P186), P189 (≠ F188), I190 (= I189), T192 (= T191), P193 (vs. gap), L194 (vs. gap)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
36% identity, 98% coverage: 4:253/255 of query aligns to 3:247/249 of 4bmsF
- active site: S137 (= S143), H147 (≠ E153), Y150 (= Y156), K154 (= K160), Q195 (= Q195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ A16), S16 (≠ G17), I18 (≠ C19), R38 (≠ L39), R39 (≠ P40), A59 (= A63), D60 (= D64), V61 (≠ A65), N87 (≠ H91), S88 (≠ A92), G89 (= G93), V110 (= V114), S137 (= S143), Y150 (= Y156), K154 (= K160), G181 (= G187), I183 (= I189), T185 (= T191), I187 (vs. gap)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
34% identity, 99% coverage: 2:254/255 of query aligns to 1:250/251 of 1zk4A
- active site: G17 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding 1-phenylethanone: A93 (≠ I95), Y155 (= Y156), Y189 (≠ F188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (≠ A16), L16 (≠ G17), I18 (≠ C19), T36 (≠ V37), G37 (≠ D38), R38 (≠ L39), H61 (≠ A63), D62 (= D64), N89 (≠ H91), A90 (= A92), G91 (= G93), I92 (≠ T94), Y155 (= Y156), G188 (= G187), I190 (= I189), T192 (= T191), L194 (≠ H193)
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
33% identity, 97% coverage: 3:249/255 of query aligns to 2:240/245 of Q8JZV9
- Y147 (= Y156) active site, Proton acceptor; mutation to F: Loss of function.
6y0sAAA R-specific alcohol dehydrogenase (see paper)
33% identity, 99% coverage: 2:254/255 of query aligns to 1:250/251 of 6y0sAAA
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
34% identity, 96% coverage: 4:249/255 of query aligns to 7:247/258 of 4wecA
- active site: G21 (= G18), S143 (= S143), Q154 (≠ E153), Y157 (= Y156), K161 (= K160)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (≠ G17), G21 (= G18), I22 (≠ C19), D41 (= D38), I42 (≠ L39), V61 (≠ A63), D62 (= D64), V63 (≠ A65), N89 (≠ H91), T141 (= T141), Y157 (= Y156), K161 (= K160), P187 (= P186), P189 (≠ F188), V190 (≠ I189)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 96% coverage: 5:249/255 of query aligns to 3:238/244 of 7krmC
- active site: G18 (= G18), S140 (= S143), Y155 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ G17), G18 (= G18), I19 (≠ C19), D38 (= D38), L39 (= L39), A60 (= A63), N61 (≠ D64), V62 (≠ A65), N88 (≠ H91), V111 (= V114), S140 (= S143), Y155 (= Y156), K159 (= K160), I188 (= I189), T190 (= T191)
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
33% identity, 94% coverage: 4:243/255 of query aligns to 3:240/262 of G9FRD7
- SSTRGI 13:18 (≠ GGAGGC 14:19) binding
- R38 (≠ L39) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ DA 64:65) binding
- N90 (≠ H91) binding
- T145 (≠ S143) binding
- Y158 (= Y156) binding ; binding
- K162 (= K160) binding
- IGT---RA 191:195 (≠ IQTAHGQR 189:196) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
33% identity, 94% coverage: 4:243/255 of query aligns to 2:239/261 of 5epoA
- active site: G16 (= G18), T144 (≠ S143), I152 (≠ P151), Y157 (= Y156), K161 (= K160), R193 (≠ Q195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G14), T14 (≠ A16), R15 (≠ G17), G16 (= G18), I17 (≠ C19), R37 (≠ L39), F61 (≠ A63), N62 (≠ D64), N89 (≠ H91), Y90 (≠ A92), G91 (= G93), Y157 (= Y156), K161 (= K160), P187 (= P186), G188 (= G187), I190 (= I189), T192 (= T191), R193 (≠ Q195), A194 (≠ R196), A195 (≠ E197)
- binding taurochenodeoxycholic acid: T93 (≠ I95), T144 (≠ S143), G146 (≠ S145), R154 (≠ E153), Y157 (= Y156), G188 (= G187), N198 (≠ E200), M199 (≠ L201), F203 (≠ V208)
Query Sequence
>SMc00778 FitnessBrowser__Smeli:SMc00778
MAGRLHGKIALISGGAGGCGLAASELFAREGAAVGIVDLPQSQGEAVAARLRSEGFRAAF
ASADASDERQVTQAVERVSGELGPITVLFNHAGTIVIRPFLETTAEEWDRLMAVNVRSMF
LMTRAVLPQMIDAGGGSIVCTSSISAVAATPMEVLYNTTKGACHMFARSVAVEFRDRNIR
CNAVCPGFIQTAHGQREVEELTRYGVDVSDAAIAAQQGRMCRPDEVAKAALYLASEDASF
VSGAHLFVDNCFTAM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory