SitesBLAST
Comparing SMc00797 FitnessBrowser__Smeli:SMc00797 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
24% identity, 98% coverage: 5:412/417 of query aligns to 3:365/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G9), G9 (= G11), I10 (= I12), D30 (= D32), N32 (≠ R34), H33 (≠ G35), K36 (≠ E38), A37 (≠ E39), T38 (= T40), A40 (≠ Y42), G41 (= G43), A42 (= A45), G43 (= G46), V44 (≠ L47), Y174 (≠ A223), A203 (≠ L253), W206 (= W256), I210 (≠ V260), Y250 (= Y299), G305 (= G352), R307 (= R354), G333 (≠ A380), A334 (≠ H381), S335 (≠ H382), G336 (= G383), L337 (≠ M384), T338 (= T385)
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
25% identity, 59% coverage: 170:414/417 of query aligns to 121:363/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ A224), V174 (≠ T225), S202 (≠ L253), G203 (= G254), W205 (= W256), F209 (≠ V260), G300 (= G352), R302 (= R354), H327 (= H379), F328 (≠ A380), R329 (≠ H381), N330 (≠ H382), G331 (= G383), I332 (≠ M384)
- binding glycolic acid: Y246 (≠ F300), R302 (= R354), R329 (≠ H381)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
26% identity, 59% coverage: 170:414/417 of query aligns to 121:363/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ F300), R302 (= R354), R329 (≠ H381)
- binding flavin-adenine dinucleotide: V174 (≠ T225), S202 (≠ L253), G203 (= G254), W205 (= W256), F209 (≠ V260), G300 (= G352), R302 (= R354), H327 (= H379), R329 (≠ H381), N330 (≠ H382), G331 (= G383), I332 (≠ M384)
- binding phosphate ion: R254 (= R309)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
26% identity, 59% coverage: 170:414/417 of query aligns to 121:363/369 of O31616
- V174 (≠ T225) binding
- H244 (≠ G298) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R354) binding
- 327:333 (vs. 379:385, 29% identical) binding
- R329 (≠ H381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 70% coverage: 122:414/417 of query aligns to 79:363/369 of S5FMM4
- K81 (≠ I124) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ L253) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ M384) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L394) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 71% coverage: 121:416/417 of query aligns to 78:371/377 of Q5L2C2
- V180 (≠ T225) binding
- R309 (= R354) binding
- 334:340 (vs. 379:385, 29% identical) binding
- R336 (≠ H381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 71% coverage: 121:414/417 of query aligns to 77:367/368 of 4yshB
- active site: I262 (≠ T312), L283 (vs. gap), G305 (= G352), N335 (≠ H382), L338 (≠ T385)
- binding flavin-adenine dinucleotide: V178 (≠ T225), S206 (≠ L253), W209 (= W256), R307 (= R354), H332 (= H379), R334 (≠ H381), N335 (≠ H382), G336 (= G383), I337 (≠ M384), L338 (≠ T385)
- binding glycine: G249 (= G298), Y251 (≠ F300), Y251 (≠ F300), A264 (= A314), R307 (= R354), R334 (≠ H381), R334 (≠ H381)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 71% coverage: 121:416/417 of query aligns to 77:369/370 of 4yshA
- active site: I262 (≠ T312), L283 (vs. gap), G305 (= G352), N335 (≠ H382), L338 (≠ T385)
- binding flavin-adenine dinucleotide: V178 (≠ T225), S206 (≠ L253), G207 (= G254), W209 (= W256), R307 (= R354), H332 (= H379), R334 (≠ H381), N335 (≠ H382), G336 (= G383), I337 (≠ M384)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 96% coverage: 2:402/417 of query aligns to 1:348/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L8), G8 (= G9), G10 (= G11), V11 (≠ I12), I12 (≠ V13), V30 (≠ L31), E31 (≠ D32), K32 (≠ R33), E38 (= E39), A39 (≠ T40), S40 (= S41), A43 (≠ N44), G45 (= G46), L46 (= L47), V171 (≠ T225), G200 (≠ L253), G201 (= G254), W203 (= W256), G298 (= G352), R300 (= R354), P301 (= P355), Y326 (≠ A380), R327 (≠ H381), N328 (≠ H382), G329 (= G383), I330 (≠ M384)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
27% identity, 52% coverage: 199:415/417 of query aligns to 172:383/383 of 5i39A
- active site: Q248 (≠ G275), P267 (≠ D294)
- binding flavin-adenine dinucleotide: A196 (= A223), A197 (= A224), G226 (≠ L253), G227 (= G254), W229 (= W256), Q248 (≠ G275), Q250 (≠ H277), G321 (= G352), M323 (≠ R354), T348 (≠ H379), G349 (≠ A380), W350 (≠ H381), G351 (= G383), M352 (= M384), T353 (= T385)
Sites not aligning to the query:
- active site: 66, 69, 70
- binding flavin-adenine dinucleotide: 30, 31, 33, 34, 35, 53, 54, 55, 62, 63, 66, 67, 69
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
28% identity, 36% coverage: 265:415/417 of query aligns to 291:433/433 of 5hxwA
- binding cetyl-trimethyl-ammonium: G291 (= G265), Y294 (≠ F268), N310 (≠ R283), E311 (= E284), F317 (vs. gap), M318 (≠ A286), S320 (≠ L288), M373 (≠ R354), E379 (≠ M360), G399 (≠ A380), W400 (≠ H381)
- binding flavin-adenine dinucleotide: F331 (≠ M304), G371 (= G352), M373 (≠ R354), T398 (≠ H379), G399 (≠ A380), W400 (≠ H381), G401 (= G383), M402 (= M384), T403 (= T385)
Sites not aligning to the query:
- active site: 58, 61, 62, 240, 284, 288
- binding flavin-adenine dinucleotide: 22, 23, 25, 26, 27, 46, 47, 53, 54, 55, 57, 58, 59, 60, 61, 188, 189, 218, 219, 221, 240, 242
1zovA Crystal structure of monomeric sarcosine oxidase from bacillus sp. Ns- 129
24% identity, 43% coverage: 237:414/417 of query aligns to 185:377/381 of 1zovA
- active site: Y254 (≠ F300), K265 (≠ T311), H269 (vs. gap), C315 (≠ G352), H345 (= H382), K348 (≠ T385)
- binding flavin-adenine dinucleotide: M201 (≠ L253), G202 (= G254), W204 (= W256), Y254 (≠ F300), C315 (≠ G352), M316 (≠ A353), Y317 (≠ R354), F342 (≠ H379), G344 (≠ H381), H345 (= H382), G346 (= G383), F347 (≠ M384), K348 (≠ T385)
Sites not aligning to the query:
- active site: 45, 48, 49, 52, 98
- binding flavin-adenine dinucleotide: 10, 13, 14, 33, 34, 39, 42, 43, 44, 49, 50, 173
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
35% identity, 20% coverage: 332:415/417 of query aligns to 363:445/447 of 5fjnA
Sites not aligning to the query:
- active site: 67, 71, 72, 252
- binding 2-aminobenzoic acid: 252, 289
- binding flavin-adenine dinucleotide: 34, 35, 37, 38, 39, 57, 58, 59, 65, 66, 67, 70, 71, 72, 73, 201, 230, 231, 233, 252, 254, 343
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
35% identity, 20% coverage: 332:415/417 of query aligns to 363:445/447 of 5fjmA
Sites not aligning to the query:
- active site: 67, 71, 72, 252
- binding flavin-adenine dinucleotide: 34, 35, 37, 38, 39, 57, 58, 59, 65, 66, 67, 70, 71, 72, 73, 201, 230, 231, 233, 252, 254, 343
6j39A Crystal structure of cmis2 with inhibitor (see paper)
26% identity, 68% coverage: 121:405/417 of query aligns to 74:359/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ D294), Y252 (≠ F300), Y267 (≠ F316), R308 (= R354), R334 (≠ H381), I335 (≠ H382)
- binding flavin-adenine dinucleotide: A174 (= A223), A203 (≠ L253), W206 (= W256), I228 (≠ H277), Y252 (≠ F300), R308 (= R354), S333 (≠ A380), R334 (≠ H381), I335 (≠ H382), G336 (= G383), V337 (≠ M384), Q338 (≠ T385)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
26% identity, 68% coverage: 121:405/417 of query aligns to 74:359/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (= A223), A203 (≠ L253), W206 (= W256), G226 (= G275), G306 (= G352), R308 (= R354), S333 (≠ A380), R334 (≠ H381), I335 (≠ H382), G336 (= G383), V337 (≠ M384), Q338 (≠ T385)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
7exsA Thermomicrobium roseum sarcosine oxidase mutant - s320r (see paper)
28% identity, 40% coverage: 231:396/417 of query aligns to 175:351/372 of 7exsA
- binding flavin-adenine dinucleotide: T196 (≠ A252), A197 (≠ L253), G198 (= G254), W200 (= W256), Y248 (≠ F300), C307 (≠ G352), L308 (≠ A353), Y309 (≠ R354), G336 (≠ H381), H337 (= H382), G338 (= G383), F339 (≠ M384), K340 (≠ T385)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 30, 31, 36, 39, 40, 41, 46, 47, 169
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 69% coverage: 130:415/417 of query aligns to 78:368/374 of 1y56B
- active site: H224 (= H277), P239 (≠ N290), G305 (= G352), M338 (≠ T385)
- binding flavin-adenine dinucleotide: E170 (≠ A223), V171 (≠ A224), T200 (≠ L253), N201 (≠ G254), W203 (= W256), G305 (= G352), Y306 (≠ A353), Y307 (≠ R354), G334 (≠ H381), H335 (= H382), G336 (= G383), F337 (≠ M384), M338 (≠ T385)
- binding flavin mononucleotide: I260 (≠ L310), R301 (≠ E348), W303 (= W350)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
Query Sequence
>SMc00797 FitnessBrowser__Smeli:SMc00797
MKTDVVVLGAGIVGISSAIHLARLGKSVVLLDRRGAGEETSYGNAGLIQREGVFPYGFPH
NFGALFRYALNNTIDASYHFRALPSLVPFLARYWWHSGFTQHQKIAHLYAPLIEHSIAEH
QDLIDASGAGDLIRKDGWMKVFRTEKERDAAYKDAERLSAGFGVNHQKLSTSELKTIEPS
IQAELAGGLRWTDPWSIRDPHSLNKAYLAYFQSLGGRLVSGDAATLEHILEGAGWRVATP
DGPLEAREVVVALGPWADTVTRKLGYHFPLAVKRGYHMHYGIREGAQLNNWVLDAEKGYF
LAPMLRGIRLTTGAEFALRDAPKTPVQLTRAERVAREFFPLAERRDEEPWMGARPCTPDM
MPVIGKAPRHEGLWFAFGHAHHGMTLGPVTGRALAQAMTGEKPVIDITPYRPERFLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory