SitesBLAST
Comparing SMc00832 FitnessBrowser__Smeli:SMc00832 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 94% coverage: 22:470/479 of query aligns to 11:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P84), G75 (= G86), S76 (≠ A87), G77 (= G88), T78 (= T89), G79 (≠ S90), L80 (= L91), A83 (≠ G94), C84 (≠ A95), P137 (= P148), G138 (≠ S149), E139 (≠ S150), A142 (= A153), T143 (= T155), G146 (= G158), N147 (= N159), S149 (≠ G161), T150 (≠ M162), A152 (≠ S164), G153 (= G165), E203 (= E214), G204 (= G215), I209 (≠ V220), E422 (= E429), H423 (= H430)
- binding fe (iii) ion: H377 (= H385), H384 (= H392), E422 (= E429)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 87% coverage: 54:471/479 of query aligns to 38:456/459 of P9WIT1
- K354 (≠ H364) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
30% identity, 91% coverage: 34:470/479 of query aligns to 13:464/465 of 3pm9A
- active site: A149 (≠ S164), L159 (≠ V174)
- binding flavin-adenine dinucleotide: P69 (= P84), Q70 (≠ R85), G71 (= G86), G72 (≠ A87), N73 (≠ G88), T74 (= T89), G75 (≠ S90), L76 (= L91), G79 (= G94), Q80 (≠ A95), L91 (= L106), L133 (≠ P148), G134 (≠ S149), A135 (≠ S150), C139 (= C154), T140 (= T155), G142 (= G157), G143 (= G158), S146 (≠ G161), T147 (≠ M162), A149 (≠ S164), G150 (= G165), E200 (= E214), G201 (= G215), I205 (= I219), I206 (≠ V220), E423 (= E429)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 87% coverage: 56:471/479 of query aligns to 40:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W323 (≠ F341), E414 (= E429), H415 (= H430), N451 (= N466)
- binding manganese (ii) ion: H370 (= H385), H377 (= H392), E414 (= E429)
- binding pyruvic acid: R319 (= R337), H370 (= H385), H377 (= H392), H415 (= H430)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R337), H369 (= H385), H376 (= H392), H414 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E429), H414 (= H430), N450 (= N466)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 87% coverage: 56:471/479 of query aligns to 40:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E429), H414 (= H430), N450 (= N466)
- binding lactic acid: R318 (= R337), H369 (= H385), H376 (= H392), H414 (= H430)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 87% coverage: 56:471/479 of query aligns to 40:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R337), W322 (≠ F341), H369 (= H385), H376 (= H392), H414 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E429), N450 (= N466)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 87% coverage: 56:471/479 of query aligns to 40:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L91), R317 (= R337), W321 (≠ F341), H368 (= H385), H375 (= H392), H413 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W321 (≠ F341), Y322 (≠ G342), E412 (= E429), H413 (= H430), N449 (= N466)
- binding manganese (ii) ion: H368 (= H385), H375 (= H392), E412 (= E429)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H369 (= H385), E413 (= E429), N450 (= N466)
- binding deaminohydroxyvaline: R319 (= R337), H414 (= H430)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), Y324 (≠ G342), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H430)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R337), W323 (≠ F341), H370 (= H385), H415 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H370 (= H385), E414 (= E429), N451 (= N466)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), Y324 (≠ G342), H370 (= H385), E414 (= E429), N451 (= N466)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R337), W323 (≠ F341), H415 (= H430)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R337), H415 (= H430)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), Y324 (≠ G342), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L91), R319 (= R337), W323 (≠ F341), H415 (= H430)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
28% identity, 87% coverage: 56:471/479 of query aligns to 40:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P84), G70 (= G86), T71 (≠ A87), G72 (= G88), T73 (= T89), G74 (≠ S90), G78 (= G94), V79 (≠ A95), L90 (= L106), P132 (= P148), G133 (≠ S149), A134 (≠ S150), G140 (= G158), M141 (≠ N159), A143 (≠ G161), T144 (≠ M162), A146 (≠ S164), S147 (≠ G165), E200 (= E214), G201 (= G215), I206 (≠ V220), W322 (≠ F341), E413 (= E429), H414 (= H430), N450 (= N466)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R337), H369 (= H385), H376 (= H392), H414 (= H430)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
27% identity, 95% coverage: 19:472/479 of query aligns to 64:518/521 of Q8N465
- S109 (≠ T65) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V83) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A87) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V103) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M109) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V128) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A145) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ G161) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ F187) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G189) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S326) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R337) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F341) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ Y350) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ C352) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ G370) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G377) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H385) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G387) to V: slight reduction in catalytic activity
- N439 (= N390) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H392) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L394) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I395) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ Y397) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E429) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H430) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G431) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
27% identity, 95% coverage: 19:472/479 of query aligns to 11:465/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R337), T337 (≠ F341), K348 (≠ C352), Y379 (≠ V383), H381 (= H385), H388 (= H392), H423 (= H430)
- binding flavin-adenine dinucleotide: W39 (≠ A48), P75 (= P84), Q76 (≠ R85), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (≠ S90), M82 (≠ L91), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), G149 (= G158), N150 (= N159), A152 (≠ G161), T153 (≠ M162), G157 (= G166), G207 (= G215), I212 (≠ V220), E422 (= E429), N459 (= N466)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E429)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
27% identity, 95% coverage: 19:472/479 of query aligns to 11:465/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ A48), P75 (= P84), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (≠ S90), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), H146 (≠ T155), G148 (= G157), G149 (= G158), N150 (= N159), A152 (≠ G161), T153 (≠ M162), A155 (≠ S164), E206 (= E214), G207 (= G215), I211 (= I219), I212 (≠ V220), E422 (= E429), N459 (= N466)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R337), T337 (≠ F341), K348 (≠ C352), Y379 (≠ V383), H381 (= H385), H388 (= H392), H423 (= H430)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E429)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
27% identity, 95% coverage: 19:472/479 of query aligns to 11:465/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ A48), P75 (= P84), G77 (= G86), G78 (≠ A87), N79 (≠ G88), T80 (= T89), G81 (≠ S90), G85 (= G94), S86 (≠ A95), L139 (≠ P148), G140 (≠ S149), A141 (≠ S150), C145 (= C154), H146 (≠ T155), G149 (= G158), N150 (= N159), A152 (≠ G161), T153 (≠ M162), A155 (≠ S164), G157 (= G166), E206 (= E214), G207 (= G215), I211 (= I219), I212 (≠ V220), E422 (= E429), N459 (= N466)
- binding d-malate: M82 (≠ L91), R333 (= R337), T337 (≠ F341), K348 (≠ C352), Y379 (≠ V383), H381 (= H385), H388 (= H392), E422 (= E429), H423 (= H430)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E429)
Query Sequence
>SMc00832 FitnessBrowser__Smeli:SMc00832
MPETIGFLKPRQAVLDRRREIVADLADLLPEGGLISDERGLKPFETDAFIAYRRMPLAVV
LPETTEHVAAVLKYCSRYGIPIVPRGAGTSLSGGAIPQEDAIVVGLSKMSRTLDIDLFNR
TATVQAGVTNLNISDAVSADGFFYAPDPSSQLACTIGGNIGMNSGGAHCLKYGVTTNNLL
GVKMVLFDGTVIELGGKALDAPGYDLLGLVCGSEGQLGIVTEATVRLIAKPEGARPVLFG
FASSESAGSCVADIIGSGIIPVAIEFMDRPAIEICEAFAQAGYPLDVEALLIVEVEGSEA
EMDATLAGIIEIARRHGVMTIRESQSALEAALIWKGRKSAFGATGRIADYICMDGTVPLS
QLSHVLRRTGEIVAGYGLRVANVFHAGDGNMHPLILYNINDPEEAARAEAAGNDILKLCV
EAGGCLTGEHGVGIEKRDLMLHQYSRADLGQQMAARAAFDPQWLMNPSKVFPLEGRPAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory