SitesBLAST
Comparing SMc00880 FitnessBrowser__Smeli:SMc00880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
47% identity, 97% coverage: 6:254/256 of query aligns to 9:256/258 of 5wjsA
- active site: G27 (= G24), S152 (= S150), Y162 (≠ I160), Y165 (= Y163), K169 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G20), T26 (≠ S23), I28 (= I25), D47 (= D44), L48 (≠ I45), D73 (= D71), L74 (= L72), N100 (= N98), A102 (= A100), L150 (≠ F148), G151 (≠ S149), S152 (= S150), K169 (= K167), P195 (= P193), G196 (= G194), W197 (≠ M195), V198 (≠ I196), K202 (≠ R200)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
50% identity, 97% coverage: 6:254/256 of query aligns to 4:252/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G20), T21 (≠ S23), I23 (= I25), D42 (= D44), I43 (= I45), C68 (≠ A70), D69 (= D71), L70 (= L72), N96 (= N98), A98 (= A100), F146 (= F148), S147 (= S149), S148 (= S150), Y161 (= Y163), K165 (= K167), P191 (= P193), G192 (= G194), W193 (≠ M195), V194 (≠ I196), R198 (= R200)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 96% coverage: 10:254/256 of query aligns to 4:251/255 of 5itvA
- active site: G18 (= G24), S141 (= S150), Y154 (= Y163), K158 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S17 (= S23), G18 (= G24), I19 (= I25), D38 (= D44), I39 (= I45), T61 (≠ A70), I63 (≠ L72), N89 (= N98), G91 (≠ A100), T139 (≠ F148), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (= G194), I186 (≠ M195), I187 (= I196)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 96% coverage: 11:255/256 of query aligns to 3:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), Q15 (≠ S23), G16 (= G24), I17 (= I25), D36 (= D44), V63 (≠ L72), N89 (= N98), A91 (= A100), S94 (vs. gap), I142 (≠ F148), S143 (= S149), S144 (= S150), Y157 (= Y163), K161 (= K167), P187 (= P193), H188 (≠ G194), I190 (= I196), I194 (≠ R200)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 95% coverage: 11:254/256 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G24), S142 (= S150), Y155 (= Y163), K159 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (= S23), G16 (= G24), I17 (= I25), D36 (= D44), I37 (= I45), A61 (= A70), D62 (= D71), T63 (≠ L72), N89 (= N98), A90 (= A99), M140 (≠ F148), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), A186 (≠ G194), Y187 (≠ M195), I188 (= I196), L192 (≠ R200)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 96% coverage: 10:254/256 of query aligns to 4:223/227 of 5itvD
- active site: G18 (= G24), S141 (= S150), Y154 (= Y163), K158 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), S17 (= S23), G18 (= G24), I19 (= I25), D38 (= D44), I39 (= I45), T61 (≠ A70), D62 (= D71), I63 (≠ L72), N89 (= N98), T139 (≠ F148), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (= G194), I187 (= I196)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
40% identity, 96% coverage: 11:256/256 of query aligns to 3:252/256 of 7do7A
- active site: G16 (= G24), S146 (= S150), Y159 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), R15 (≠ S23), G16 (= G24), I17 (= I25), S37 (vs. gap), D66 (≠ I68), A67 (≠ Q69), N93 (= N98), A94 (= A99), G95 (≠ A100), I96 (≠ R101), V144 (≠ F148), S145 (= S149), S146 (= S150), Y159 (= Y163), K163 (= K167), P189 (= P193), G190 (= G194), I192 (= I196), T194 (= T198), I196 (≠ R200)
- binding beta-L-rhamnopyranose: F99 (≠ R104), S146 (= S150), S148 (≠ A152), Q156 (≠ I160), Y159 (= Y163), N197 (≠ Q201), D235 (= D239), M236 (≠ S240), R238 (≠ A242)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
40% identity, 96% coverage: 11:256/256 of query aligns to 3:252/256 of 7b81A
- active site: G16 (= G24), S146 (= S150), Y159 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S14 (≠ G22), R15 (≠ S23), I17 (= I25), D66 (≠ I68), A67 (≠ Q69), N93 (= N98), A94 (= A99), G95 (≠ A100), I96 (≠ R101), T116 (≠ V121), V144 (≠ F148), S146 (= S150), Y159 (= Y163), K163 (= K167), P189 (= P193), G190 (= G194), I192 (= I196), T194 (= T198), I196 (≠ R200)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 95% coverage: 11:254/256 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), M16 (≠ I25), D35 (= D44), I36 (= I45), I62 (≠ L72), N88 (= N98), G90 (≠ A100), I138 (≠ F148), S140 (= S150), Y152 (= Y163), K156 (= K167), I185 (= I196)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 95% coverage: 11:254/256 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S23) binding
- D36 (= D44) binding
- D62 (= D71) binding
- I63 (≠ L72) binding
- N89 (= N98) binding
- Y153 (= Y163) binding
- K157 (= K167) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
39% identity, 96% coverage: 11:256/256 of query aligns to 3:243/247 of 7do6A
- active site: G16 (= G24), S146 (= S150), Y159 (= Y163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (≠ G22), R15 (≠ S23), G16 (= G24), I17 (= I25), H36 (vs. gap), S37 (vs. gap), G42 (≠ A46), D66 (≠ I68), A67 (≠ Q69), N93 (= N98), A94 (= A99), G95 (≠ A100), I96 (≠ R101), T116 (≠ V121), S146 (= S150), Y159 (= Y163), K163 (= K167), I192 (= I196)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
39% identity, 95% coverage: 14:255/256 of query aligns to 6:236/240 of 2d1yA
- active site: G16 (= G24), S135 (= S150), N145 (≠ I160), Y148 (= Y163), K152 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), R15 (≠ S23), I17 (= I25), D36 (= D44), L37 (≠ I45), R38 (≠ A46), V55 (≠ A70), D56 (= D71), L57 (= L72), N83 (= N98), A84 (= A99), A85 (= A100), I86 (≠ R101), V133 (≠ F148), S135 (= S150), Y148 (= Y163), K152 (= K167), P178 (= P193), G179 (= G194), I181 (= I196), T183 (= T198), A185 (≠ L206), V186 (≠ T207)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 95% coverage: 14:256/256 of query aligns to 2:238/239 of 3sj7A
- active site: G12 (= G24), S138 (= S150), Q148 (≠ I160), Y151 (= Y163), K155 (= K167)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), S10 (≠ G22), R11 (≠ S23), I13 (= I25), N31 (≠ D44), Y32 (≠ I45), A33 (= A46), G34 (≠ A47), S35 (vs. gap), A58 (= A70), N59 (≠ D71), V60 (≠ L72), N86 (= N98), A87 (= A99), T109 (≠ V121), S138 (= S150), Y151 (= Y163), K155 (= K167), P181 (= P193), G182 (= G194)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
32% identity, 96% coverage: 11:255/256 of query aligns to 3:244/247 of 2ewmB
- active site: G16 (= G24), S139 (= S150), Y149 (≠ I160), Y152 (= Y163), K156 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), N15 (≠ S23), G16 (= G24), I17 (= I25), D36 (= D44), L37 (≠ I45), C59 (≠ A70), D60 (= D71), V61 (≠ L72), N87 (= N98), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), S183 (≠ G194), L184 (≠ M195), V185 (≠ I196), T189 (≠ R200)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 96% coverage: 11:256/256 of query aligns to 3:242/244 of 7krmC
- active site: G18 (= G24), S140 (= S150), Y155 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (= S23), G18 (= G24), I19 (= I25), D38 (= D44), L39 (≠ I45), A60 (= A70), N61 (≠ D71), V62 (≠ L72), N88 (= N98), V111 (= V121), S140 (= S150), Y155 (= Y163), K159 (= K167), I188 (= I196), T190 (= T198)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
32% identity, 96% coverage: 11:255/256 of query aligns to 5:246/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 96% coverage: 11:255/256 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G24), S142 (= S150), Q152 (≠ I160), Y155 (= Y163), K159 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (≠ G22), R15 (≠ S23), G16 (= G24), I17 (= I25), N35 (≠ V43), Y36 (≠ D44), N37 (≠ I45), G38 (≠ A46), S39 (≠ A47), N63 (≠ D71), V64 (≠ L72), N90 (= N98), A91 (= A99), I93 (≠ R101), I113 (≠ V121), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), I188 (= I196), T190 (= T198)
1cydA Carbonyl reductase complexed with NADPH and 2-propanol (see paper)
36% identity, 93% coverage: 17:254/256 of query aligns to 9:238/242 of 1cydA
- active site: G16 (= G24), S134 (= S150), L144 (≠ I160), Y147 (= Y163), K151 (= K167)
- binding isopropyl alcohol: S134 (= S150), Y147 (= Y163), V188 (≠ L204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), G14 (= G22), K15 (≠ S23), I17 (= I25), R37 (≠ I45), T38 (≠ A46), D58 (= D71), L59 (= L72), N81 (= N98), A83 (= A100), V104 (= V121), V132 (≠ F148), S134 (= S150), Y147 (= Y163), K151 (= K167), P177 (= P193), T178 (≠ G194), V179 (≠ M195), V180 (≠ I196), T182 (= T198), M184 (≠ R200), G185 (≠ Q201)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 95% coverage: 14:256/256 of query aligns to 5:245/246 of 3osuA
P08074 Carbonyl reductase [NADPH] 2; Adipocyte protein P27; AP27; Lung carbonyl reductase; LCR; NADPH-dependent carbonyl reductase 2; EC 1.1.1.184 from Mus musculus (Mouse) (see 2 papers)
36% identity, 93% coverage: 17:254/256 of query aligns to 11:240/244 of P08074
- 11:39 (vs. 17:45, 48% identical) binding
- T38 (≠ D44) mutation to R: Converts the coenzyme specificity from NADP to NAD.
Query Sequence
>SMc00880 FitnessBrowser__Smeli:SMc00880
MTLPSSQFPDLRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQ
TGQAPHFIQADLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLS
VNLRHLFFMCQAVAPHMQRQGGGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGK
LGPDNIRVNAILPGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCLFLASDS
SAAMTAQAMIIDGGVF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory