Comparing SMc00883 FitnessBrowser__Smeli:SMc00883 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
28% identity, 96% coverage: 14:294/294 of query aligns to 10:288/289 of Q9A9Z1
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
28% identity, 96% coverage: 14:294/294 of query aligns to 10:288/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
28% identity, 96% coverage: 14:294/294 of query aligns to 10:288/289 of 7plbB
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
26% identity, 91% coverage: 19:286/294 of query aligns to 15:299/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
26% identity, 91% coverage: 19:286/294 of query aligns to 15:299/307 of 5d9bA
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
29% identity, 64% coverage: 98:286/294 of query aligns to 96:291/299 of Q15493
Sites not aligning to the query:
4gncA Human smp30/gnl-1,5-ag complex (see paper)
29% identity, 64% coverage: 98:286/294 of query aligns to 95:290/298 of 4gncA
Sites not aligning to the query:
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
29% identity, 64% coverage: 98:286/294 of query aligns to 94:289/297 of 3g4hA
Sites not aligning to the query:
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
27% identity, 65% coverage: 97:286/294 of query aligns to 93:289/297 of 4gnaA
Sites not aligning to the query:
4gn9A Mouse smp30/gnl-glucose complex (see paper)
27% identity, 65% coverage: 97:286/294 of query aligns to 93:289/297 of 4gn9A
Sites not aligning to the query:
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
27% identity, 65% coverage: 97:286/294 of query aligns to 93:289/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
27% identity, 65% coverage: 97:286/294 of query aligns to 93:289/297 of 4gn7A
Sites not aligning to the query:
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
28% identity, 63% coverage: 72:257/294 of query aligns to 80:273/290 of 3e5zA
Sites not aligning to the query:
2dsoC Crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus (see paper)
25% identity, 46% coverage: 105:238/294 of query aligns to 135:270/323 of 2dsoC
Sites not aligning to the query:
Q99QV3 Lactonase drp35; EC 3.1.1.- from Staphylococcus aureus (strain Mu50 / ATCC 700699) (see paper)
27% identity, 37% coverage: 129:238/294 of query aligns to 161:272/324 of Q99QV3
Sites not aligning to the query:
>SMc00883 FitnessBrowser__Smeli:SMc00883
MTDLVPFSGRTLSEAASELGEGPTFDPGTGTAWWFNITGRELHELHLESGRKAIHPLPFL
GSVLAVIDPLRQLIASDQGLFVRDTESSKLGHFATLEEKPGNRSNDGRIHPCGALWIGTM
GRSAEKHAGAIYHVAGSRVTKLYSNITIPNAICFSPDGATAYFTDTDVNQLMRVDIDPAT
ALPTGDPVLLSDESTSPGGVDGAVCDADGLIWNARWGASAVEVYKPDGQKVARYAVPATQ
PSCPAFVGAKAERLLVTSAWQGMDDAARAADPHAGKTFELGIEVKGRFEPAFRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory