SitesBLAST
Comparing SMc00936 FitnessBrowser__Smeli:SMc00936 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
32% identity, 94% coverage: 19:409/415 of query aligns to 28:410/494 of 1tdjA
- active site: K58 (= K49), A83 (= A75), E209 (= E207), S213 (≠ A211), C215 (≠ S213), G237 (= G235), L310 (≠ V308), S311 (= S309)
- binding pyridoxal-5'-phosphate: F57 (≠ Y48), K58 (= K49), N85 (= N77), G184 (= G182), G185 (= G183), G186 (= G184), G187 (= G185), G237 (= G235), E282 (= E281), S311 (= S309), G312 (= G310)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
32% identity, 94% coverage: 19:409/415 of query aligns to 32:414/514 of P04968
- K62 (= K49) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N77) binding
- GGGGL 188:192 (= GGGGL 182:186) binding
- S315 (= S309) binding
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
31% identity, 76% coverage: 3:317/415 of query aligns to 7:312/319 of A4F2N8
- K53 (= K49) mutation to A: Loss of enzymatic activity.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
32% identity, 77% coverage: 3:321/415 of query aligns to 10:321/326 of 2gn2A
- active site: K56 (= K49), A81 (= A75), Q207 (≠ E207), V211 (≠ A211), G213 (≠ S213), G235 (= G235), I308 (≠ V308), S309 (= S309)
- binding cytidine-5'-monophosphate: R51 (≠ P44), T52 (≠ V45), G53 (≠ R46), A114 (≠ K108), D117 (≠ M111), Y118 (≠ F112), N312 (= N312)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
28% identity, 75% coverage: 3:315/415 of query aligns to 22:329/339 of Q7XSN8
- E219 (= E207) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S213) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
28% identity, 76% coverage: 4:317/415 of query aligns to 8:312/319 of 2zr8A
- active site: K53 (= K49), S78 (≠ A75), E204 (= E207), G208 (≠ A211), D210 (≠ S213), G232 (= G235), I303 (≠ V308), S304 (= S309)
- binding magnesium ion: E204 (= E207), G208 (≠ A211), D210 (≠ S213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y48), K53 (= K49), S77 (= S74), S78 (≠ A75), N80 (= N77), H81 (= H78), P147 (= P147), G179 (≠ V181), G180 (= G182), G181 (= G183), G182 (= G184), G232 (= G235), E277 (= E281), T279 (≠ A283), S304 (= S309)
- binding serine: S78 (≠ A75), R129 (≠ C129), D231 (= D234), G232 (= G235), A233 (= A236), Q234 (≠ A237), T235 (≠ V238)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
28% identity, 76% coverage: 4:317/415 of query aligns to 8:312/319 of 2zpuA
- active site: K53 (= K49), S78 (≠ A75), E204 (= E207), G208 (≠ A211), D210 (≠ S213), G232 (= G235), I303 (≠ V308), S304 (= S309)
- binding magnesium ion: E204 (= E207), G208 (≠ A211), D210 (≠ S213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y48), K53 (= K49), S77 (= S74), S78 (≠ A75), N80 (= N77), H81 (= H78), P147 (= P147), G179 (≠ V181), G180 (= G182), G181 (= G183), G182 (= G184), G232 (= G235), E277 (= E281), T279 (≠ A283), S304 (= S309)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 76% coverage: 4:317/415 of query aligns to 12:316/323 of O59791
- S82 (≠ A75) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
28% identity, 76% coverage: 4:317/415 of query aligns to 7:311/318 of 1wtcA
- active site: K52 (= K49), S77 (≠ A75), E203 (= E207), G207 (≠ A211), D209 (≠ S213), G231 (= G235), I302 (≠ V308), S303 (= S309)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ P17), K47 (≠ P44), M48 (≠ V45), A109 (≠ D107), A110 (≠ K108), Y114 (≠ F112)
- binding magnesium ion: E203 (= E207), G207 (≠ A211), D209 (≠ S213)
- binding pyridoxal-5'-phosphate: F51 (≠ Y48), K52 (= K49), N79 (= N77), G178 (≠ V181), G179 (= G182), G180 (= G183), G181 (= G184), G231 (= G235), E276 (= E281), T278 (≠ A283), S303 (= S309)
1v71A Crystal structure of s.Pombe serine racemase
28% identity, 76% coverage: 4:317/415 of query aligns to 7:311/318 of 1v71A
- active site: K52 (= K49), S77 (≠ A75), E203 (= E207), G207 (≠ A211), D209 (≠ S213), G231 (= G235), I302 (≠ V308), S303 (= S309)
- binding magnesium ion: E203 (= E207), G207 (≠ A211), D209 (≠ S213)
- binding pyridoxal-5'-phosphate: F51 (≠ Y48), K52 (= K49), N79 (= N77), G178 (≠ V181), G179 (= G182), G180 (= G183), G181 (= G184), G231 (= G235), E276 (= E281), T278 (≠ A283), S303 (= S309), G304 (= G310)
6zspAAA serine racemase bound to atp and malonate. (see paper)
28% identity, 75% coverage: 4:315/415 of query aligns to 8:309/320 of 6zspAAA
- active site: K53 (= K49), S74 (≠ A75), E200 (= E207), A204 (= A211), D206 (≠ S213), G229 (= G235), L302 (≠ V308), S303 (= S309)
- binding adenosine-5'-triphosphate: S28 (≠ N24), S29 (≠ E25), I30 (≠ H26), K48 (≠ P44), T49 (≠ V45), Q79 (= Q80), Y111 (≠ F112), E266 (≠ N274), R267 (≠ V275), K269 (≠ G277), N306 (= N312)
- binding magnesium ion: E200 (= E207), A204 (= A211), D206 (≠ S213)
- binding malonate ion: K53 (= K49), S73 (= S74), S74 (≠ A75), N76 (= N77), H77 (= H78), R125 (≠ F126), G229 (= G235), S232 (≠ A239)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
28% identity, 75% coverage: 4:315/415 of query aligns to 9:312/322 of 3l6bA
- active site: K54 (= K49), S77 (≠ A75), E203 (= E207), A207 (= A211), D209 (≠ S213), G232 (= G235), T278 (≠ A283), L305 (≠ V308), S306 (= S309)
- binding malonate ion: K54 (= K49), S76 (= S74), S77 (≠ A75), N79 (= N77), H80 (= H78), R128 (≠ F126), G232 (= G235)
- binding manganese (ii) ion: E203 (= E207), A207 (= A211), D209 (≠ S213)
- binding pyridoxal-5'-phosphate: F53 (≠ Y48), K54 (= K49), N79 (= N77), G178 (= G182), G179 (= G183), G180 (= G184), G181 (= G185), M182 (≠ L186), V233 (≠ A236), E276 (= E281), T278 (≠ A283), S306 (= S309), G307 (= G310)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
29% identity, 75% coverage: 4:315/415 of query aligns to 8:316/323 of 7nbfAAA
- active site: K53 (= K49), S81 (≠ A75), E207 (= E207), A211 (= A211), D213 (≠ S213), G236 (= G235), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E207), A211 (= A211), D213 (≠ S213)
- binding magnesium ion: N244 (= N245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y48), K53 (= K49), N83 (= N77), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (≠ A283), S310 (= S309), G311 (= G310)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ P17), L22 (≠ P18), T23 (= T19), P24 (= P20), L26 (≠ Q22), T27 (≠ L23), F46 (≠ L42)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
29% identity, 75% coverage: 4:315/415 of query aligns to 8:316/323 of 7nbdAAA
- active site: K53 (= K49), S81 (≠ A75), E207 (= E207), A211 (= A211), D213 (≠ S213), G236 (= G235), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E207), A211 (= A211), D213 (≠ S213)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ L273), L278 (≠ V279), V314 (≠ F313), L316 (≠ F315)
- binding magnesium ion: N244 (= N245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y48), K53 (= K49), N83 (= N77), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), E280 (= E281), T282 (≠ A283), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
29% identity, 75% coverage: 4:315/415 of query aligns to 8:316/323 of 7nbcCCC
- active site: K53 (= K49), S81 (≠ A75), E207 (= E207), A211 (= A211), D213 (≠ S213), G236 (= G235), L309 (≠ V308), S310 (= S309)
- binding biphenyl-4-ylacetic acid: T78 (≠ C72), H79 (≠ A73), H84 (= H78), V148 (= V145), H149 (≠ P146), P150 (= P147)
- binding calcium ion: E207 (= E207), A211 (= A211), D213 (≠ S213)
- binding pyridoxal-5'-phosphate: F52 (≠ Y48), K53 (= K49), N83 (= N77), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (≠ A283), S310 (= S309), G311 (= G310)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
29% identity, 75% coverage: 4:315/415 of query aligns to 8:316/323 of 7nbcAAA
- active site: K53 (= K49), S81 (≠ A75), E207 (= E207), A211 (= A211), D213 (≠ S213), G236 (= G235), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E207), A211 (= A211), D213 (≠ S213)
- binding magnesium ion: N244 (= N245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y48), K53 (= K49), N83 (= N77), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (≠ A283), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
28% identity, 75% coverage: 4:314/415 of query aligns to 8:310/310 of 7nbgDDD
- active site: K53 (= K49), S76 (≠ A75), E202 (= E207), A206 (= A211), D208 (≠ S213), G231 (= G235), L304 (≠ V308), S305 (= S309)
- binding calcium ion: E202 (= E207), A206 (= A211), D208 (≠ S213)
- binding magnesium ion: N239 (= N245)
- binding ortho-xylene: S76 (≠ A75), Q81 (= Q80), I96 (≠ V95), Y113 (≠ F112)
- binding pyridoxal-5'-phosphate: F52 (≠ Y48), K53 (= K49), N78 (= N77), G177 (= G182), G178 (= G183), G179 (= G184), G180 (= G185), M181 (≠ L186), G231 (= G235), V232 (≠ A236), E275 (= E281), T277 (≠ A283), S305 (= S309), G306 (= G310)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
29% identity, 75% coverage: 4:315/415 of query aligns to 8:316/322 of 7nbgAAA
- active site: K53 (= K49), S81 (≠ A75), E207 (= E207), A211 (= A211), D213 (≠ S213), G236 (= G235), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E207), A211 (= A211), D213 (≠ S213)
- binding pyridoxal-5'-phosphate: F52 (≠ Y48), K53 (= K49), N83 (= N77), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (≠ A283), S310 (= S309), G311 (= G310)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A75), G85 (≠ A79), Q86 (= Q80), I101 (≠ V95), K111 (= K105), I115 (≠ T109), Y118 (≠ F112)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
29% identity, 75% coverage: 4:315/415 of query aligns to 8:316/320 of 7nbhAAA
- active site: K53 (= K49), S81 (≠ A75), E207 (= E207), A211 (= A211), D213 (≠ S213), G236 (= G235), L309 (≠ V308), S310 (= S309)
- binding calcium ion: E207 (= E207), A211 (= A211), D213 (≠ S213)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A75), G85 (≠ A79), Q86 (= Q80), K111 (= K105), I115 (≠ T109), Y118 (≠ F112), D235 (= D234), P281 (= P282), N313 (= N312), V314 (≠ F313), D315 (= D314)
5cvcA Structure of maize serine racemase (see paper)
28% identity, 78% coverage: 4:328/415 of query aligns to 4:326/329 of 5cvcA
- active site: K52 (= K49), S77 (≠ A75), E203 (= E207), A207 (= A211), D209 (≠ S213), G231 (= G235), V306 (= V308), S307 (= S309)
- binding magnesium ion: E203 (= E207), A207 (= A211), D209 (≠ S213)
- binding pyridoxal-5'-phosphate: F51 (≠ Y48), K52 (= K49), N79 (= N77), S178 (≠ G182), G179 (= G183), G180 (= G184), G181 (= G185), L232 (≠ A236), E275 (= E281), S307 (= S309), G308 (= G310)
Query Sequence
>SMc00936 FitnessBrowser__Smeli:SMc00936
MKQDVEKAAAAMREIFPPTPLQLNEHLSARCGATVFLKREDLSPVRSYKIRGAFNFFRKS
LGSGAAGKTFVCASAGNHAQGFAFVCRHFGVPGVVFMPVTTPQQKIDKTRMFGAEFITIR
LVGDIFDQCYKAAREHVEAIGGVMVPPFDHDDIIEGQATVAAEIAEQLPAGPVADLVVLP
VGGGGLAAGVTGYLGDSLSADRFLFCEPEGAPSFRRSLELGGVVTLDQVDNFVDGAAVAR
IGDLNFAALRRFSPEQVMLLPENAICLTITEMLNVEGVVLEPAGALAITALEALGRDSLE
GKIVVAVVSGGNFDFERLPDVKERAMRHAGLKKYFILRMAQRPGALRDFLGLLGEEDDIA
RFEYLKKSARNFGSVLIGIETKHAENFPVLKQRFDAAGLRYQDITENEMLANFVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory