SitesBLAST
Comparing SMc00985 FitnessBrowser__Smeli:SMc00985 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
57% identity, 98% coverage: 7:474/480 of query aligns to 3:465/465 of 3pm9A
- active site: A149 (= A155), L159 (≠ N165)
- binding flavin-adenine dinucleotide: P69 (= P73), Q70 (= Q74), G71 (= G75), G72 (= G76), N73 (= N77), T74 (= T78), G75 (= G79), L76 (≠ H80), G79 (= G83), Q80 (= Q84), L91 (= L97), L133 (= L139), G134 (= G140), A135 (≠ S141), C139 (≠ A145), T140 (≠ R146), G142 (= G148), G143 (= G149), S146 (= S152), T147 (= T153), A149 (= A155), G150 (= G156), E200 (= E206), G201 (= G207), I205 (≠ V211), I206 (= I212), E423 (= E432)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
38% identity, 98% coverage: 4:474/480 of query aligns to 26:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
38% identity, 98% coverage: 7:474/480 of query aligns to 10:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R336), T337 (≠ S340), K348 (= K351), Y379 (≠ F384), H381 (= H386), H388 (= H393), H423 (= H433)
- binding flavin-adenine dinucleotide: W39 (≠ E36), P75 (= P73), Q76 (= Q74), G77 (= G75), G78 (= G76), N79 (= N77), T80 (= T78), G81 (= G79), M82 (≠ H80), G85 (= G83), S86 (≠ Q84), L139 (= L139), G140 (= G140), A141 (≠ S141), C145 (≠ A145), G149 (= G149), N150 (= N150), A152 (≠ S152), T153 (= T153), G157 (= G157), G207 (= G207), I212 (= I212), E422 (= E432), N459 (= N469)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E432)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
38% identity, 98% coverage: 7:474/480 of query aligns to 10:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ E36), P75 (= P73), G77 (= G75), G78 (= G76), N79 (= N77), T80 (= T78), G81 (= G79), G85 (= G83), S86 (≠ Q84), L139 (= L139), G140 (= G140), A141 (≠ S141), C145 (≠ A145), H146 (≠ R146), G148 (= G148), G149 (= G149), N150 (= N150), A152 (≠ S152), T153 (= T153), A155 (= A155), E206 (= E206), G207 (= G207), I211 (≠ V211), I212 (= I212), E422 (= E432), N459 (= N469)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R336), T337 (≠ S340), K348 (= K351), Y379 (≠ F384), H381 (= H386), H388 (= H393), H423 (= H433)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E432)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
38% identity, 98% coverage: 7:474/480 of query aligns to 10:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ E36), P75 (= P73), G77 (= G75), G78 (= G76), N79 (= N77), T80 (= T78), G81 (= G79), G85 (= G83), S86 (≠ Q84), L139 (= L139), G140 (= G140), A141 (≠ S141), C145 (≠ A145), H146 (≠ R146), G149 (= G149), N150 (= N150), A152 (≠ S152), T153 (= T153), A155 (= A155), G157 (= G157), E206 (= E206), G207 (= G207), I211 (≠ V211), I212 (= I212), E422 (= E432), N459 (= N469)
- binding d-malate: M82 (≠ H80), R333 (= R336), T337 (≠ S340), K348 (= K351), Y379 (≠ F384), H381 (= H386), H388 (= H393), E422 (= E432), H423 (= H433)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E432)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
38% identity, 98% coverage: 7:474/480 of query aligns to 10:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R336), T337 (≠ S340), K348 (= K351), Y379 (≠ F384), H381 (= H386), H388 (= H393), N390 (= N395), H423 (= H433)
- binding flavin-adenine dinucleotide: W39 (≠ E36), P75 (= P73), G77 (= G75), G78 (= G76), N79 (= N77), T80 (= T78), G81 (= G79), M82 (≠ H80), G85 (= G83), S86 (≠ Q84), L139 (= L139), G140 (= G140), A141 (≠ S141), C145 (≠ A145), G149 (= G149), N150 (= N150), A152 (≠ S152), T153 (= T153), A155 (= A155), G157 (= G157), G207 (= G207), I212 (= I212), E422 (= E432), H423 (= H433)
- binding zinc ion: H381 (= H386), H388 (= H393), E422 (= E432)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
38% identity, 98% coverage: 7:474/480 of query aligns to 11:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ E36), P76 (= P73), G78 (= G75), G79 (= G76), N80 (= N77), T81 (= T78), G82 (= G79), M83 (≠ H80), G86 (= G83), S87 (≠ Q84), L140 (= L139), A142 (≠ S141), C146 (≠ A145), H147 (≠ R146), G150 (= G149), N151 (= N150), A153 (≠ S152), T154 (= T153), G208 (= G207), I212 (≠ V211), I213 (= I212), E423 (= E432), N460 (= N469)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
38% identity, 98% coverage: 7:474/480 of query aligns to 63:517/521 of Q8N465
- S109 (≠ V54) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V72) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G76) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V94) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L100) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (= C119) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P136) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S152) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P178) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G180) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ N325) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R336) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S340) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ S349) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K351) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ V372) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (= A379) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H386) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G388) to V: slight reduction in catalytic activity
- N439 (= N391) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H393) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N395) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I396) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ Q398) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E432) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H433) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G434) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 97% coverage: 9:474/480 of query aligns to 3:456/459 of P9WIT1
- K354 (≠ A363) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 89% coverage: 47:475/480 of query aligns to 47:465/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P73), G75 (= G75), S76 (≠ G76), G77 (≠ N77), T78 (= T78), G79 (= G79), L80 (≠ H80), A83 (≠ G83), C84 (≠ Q84), P137 (≠ L139), G138 (= G140), E139 (= E142), A142 (= A145), T143 (≠ R146), G146 (= G149), N147 (= N150), S149 (= S152), T150 (= T153), A152 (= A155), G153 (= G156), E203 (= E206), G204 (= G207), I209 (= I212), E422 (= E432), H423 (= H433)
- binding fe (iii) ion: H377 (= H386), H384 (= H393), E422 (= E432)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R329), W322 (= W333), H369 (= H386), H376 (= H393), H414 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), W322 (= W333), E413 (= E432), N450 (= N469)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E432)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ H80), R317 (= R329), W321 (= W333), H368 (= H386), H375 (= H393), H413 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), W321 (= W333), Y322 (≠ H334), E412 (= E432), H413 (= H433), N449 (= N469)
- binding manganese (ii) ion: H368 (= H386), H375 (= H393), E412 (= E432)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), W322 (= W333), E413 (= E432), H414 (= H433), N450 (= N469)
- binding lactic acid: R318 (= R329), H369 (= H386), H376 (= H393), H414 (= H433)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E432)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R329), H369 (= H386), H376 (= H393), H414 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), W322 (= W333), E413 (= E432), H414 (= H433), N450 (= N469)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E432)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R329), W322 (= W333), H369 (= H386), H376 (= H393), H413 (= H433)
- binding flavin-adenine dinucleotide: E32 (≠ R38), P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), W322 (= W333), E412 (= E432), H413 (= H433), N449 (= N469)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E412 (= E432)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R329), W322 (= W333), S336 (≠ K351), H369 (= H386), H376 (= H393), H413 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), E412 (= E432), N449 (= N469)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E412 (= E432)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ R38), P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), W323 (= W333), E414 (= E432), H415 (= H433), N451 (= N469)
- binding manganese (ii) ion: H370 (= H386), H377 (= H393), E414 (= E432)
- binding pyruvic acid: R319 (= R329), H370 (= H386), H377 (= H393), H415 (= H433)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ R38), P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), W322 (= W333), E413 (= E432), H414 (= H433), N450 (= N469)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R329), H369 (= H386), H376 (= H393), H414 (= H433)
- binding manganese (ii) ion: H369 (= H386), H376 (= H393), E413 (= E432)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), Y324 (≠ H334), H370 (= H386), E414 (= E432), N451 (= N469)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R329), W323 (= W333), H415 (= H433)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 98% coverage: 7:474/480 of query aligns to 2:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R329), W323 (= W333), H370 (= H386), H415 (= H433)
- binding flavin-adenine dinucleotide: P68 (= P73), G70 (= G75), T71 (≠ G76), G72 (≠ N77), T73 (= T78), G74 (= G79), G78 (= G83), V79 (≠ Q84), L90 (= L97), P132 (≠ L139), G133 (= G140), A134 (≠ S141), G140 (= G149), M141 (≠ N150), A143 (≠ S152), T144 (= T153), A146 (= A155), S147 (≠ G156), E200 (= E206), G201 (= G207), I206 (= I212), H370 (= H386), E414 (= E432), N451 (= N469)
Query Sequence
>SMc00985 FitnessBrowser__Smeli:SMc00985
MTTVLPSPELIASFVDIVGPGNALTAPADTAPYLVESRGLYRGTTPLVLRPGSVEEVSLV
MRLASQTRTAVVPQGGNTGHVAGQIPREGKADVVLSLERLNRIRDIDPVGNVIVADAGCI
LADIQKAADDVDRLFPLSLGSEGSARIGGNLSTNAGGTAVLAYGNMRQLCLGLEVVLPTG
EIWDGLRRLRKDNTGYDLRDLFIGAEGTLGVITGAVLKLFPKPRGHQVAFAGLRSVEDAL
TLFDRATSVCGPALTGFELMPRLGIEFTTRHIAGVRDPMETTHPWYALIDISTSDTAESA
ERMVQDLLEAVIADGLVENAVIAQNEAQRRALWHMRESMSPAQKPEGGSIKHDVSVPVSS
IPAFMTEADALVSKAIPGARICAFGHMGDGNIHYNISQPVGADKQSFLDRWREINAIVHA
VVLKHDGSISAEHGIGQLKRDELAAIRSPIEIELMRRIKHAFDPAGIMNPDKVLREDRGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory