SitesBLAST
Comparing SMc01047 FitnessBrowser__Smeli:SMc01047 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
38% identity, 94% coverage: 8:278/287 of query aligns to 6:272/277 of 3daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (= Y33), R50 (= R52), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (≠ T186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
38% identity, 94% coverage: 8:278/287 of query aligns to 6:272/277 of 2daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (= Y33), V33 (= V35), R50 (= R52), R98 (= R100), H100 (= H102), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (≠ T186), N182 (= N187), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), T241 (≠ A247)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
38% identity, 94% coverage: 8:278/287 of query aligns to 6:272/277 of 1daaA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding pyridoxal-5'-phosphate: R50 (= R52), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (≠ T186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
38% identity, 94% coverage: 8:278/287 of query aligns to 7:273/283 of P19938
- Y32 (= Y33) binding
- R51 (= R52) binding
- R99 (= R100) binding
- H101 (= H102) binding
- K146 (= K149) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E182) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L207) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
38% identity, 94% coverage: 8:278/287 of query aligns to 6:272/280 of 3lqsA
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), L201 (= L207)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (= V35), R50 (= R52), E177 (= E182), S180 (≠ A185), S181 (≠ T186), N182 (= N187), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247), T242 (= T248)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
36% identity, 94% coverage: 8:278/287 of query aligns to 6:272/282 of 1a0gB
- active site: Y31 (= Y33), V33 (= V35), K145 (= K149), E177 (= E182), A201 (≠ L207)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R52), K145 (= K149), E177 (= E182), S180 (≠ A185), S181 (≠ T186), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
33% identity, 97% coverage: 6:283/287 of query aligns to 5:282/290 of 5mr0D
- active site: F32 (≠ Y33), G34 (≠ V35), K150 (= K149), E183 (= E182), L206 (= L207)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R52), G100 (≠ H102), L101 (≠ V103), K150 (= K149), Y154 (≠ L153), E183 (= E182), G186 (≠ A185), D187 (≠ T186), L206 (= L207), I209 (≠ V210), T210 (= T211), G245 (≠ A246), T246 (≠ A247)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
32% identity, 96% coverage: 4:278/287 of query aligns to 4:278/290 of 5e25A
- active site: F33 (≠ Y33), G35 (≠ V35), K151 (= K149), E184 (= E182), L207 (= L207)
- binding 2-oxoglutaric acid: Y88 (≠ L88), K151 (= K149), T247 (≠ A247), A248 (≠ T248)
- binding pyridoxal-5'-phosphate: R52 (= R52), K151 (= K149), Y155 (≠ L153), E184 (= E182), G187 (≠ A185), D188 (≠ T186), L207 (= L207), G209 (= G209), I210 (≠ V210), T211 (= T211), G246 (≠ A246), T247 (≠ A247)
7p3tB Transaminase of gamma-proteobacterium (see paper)
33% identity, 98% coverage: 4:283/287 of query aligns to 5:284/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R52), K153 (= K149), R157 (≠ L153), E186 (= E182), S187 (≠ G183), A188 (= A184), A189 (= A185), S190 (≠ T186), G210 (= G209), I211 (≠ V210), T212 (= T211), T248 (≠ A247)
8raiA Crystal structure of d-amino acid transaminase from haliscomenobacter hydrossis point mutant r90i complexed with phenylhydrazine (see paper)
29% identity, 97% coverage: 1:278/287 of query aligns to 2:271/282 of 8raiA
- binding [6-methyl-5-oxidanyl-4-[(2-phenylhydrazinyl)methyl]pyridin-3-yl]methyl dihydrogen phosphate: F34 (≠ Y33), R53 (= R52), R138 (= R142), K144 (= K149), Y148 (≠ L153), E177 (= E182), A179 (= A184), R180 (≠ A185), S181 (≠ T186), N182 (= N187), L200 (= L207), G202 (= G209), I203 (≠ V210), T204 (= T211), T240 (≠ A247)
7p7xA Crystal structure of d-amino acid transaminase from haliscomenobacter hydrossis (holo form). (see paper)
29% identity, 97% coverage: 1:278/287 of query aligns to 2:271/282 of 7p7xA
- binding pyridoxal-5'-phosphate: R53 (= R52), R138 (= R142), K144 (= K149), Y148 (≠ L153), E177 (= E182), A179 (= A184), R180 (≠ A185), S181 (≠ T186), L200 (= L207), G202 (= G209), I203 (≠ V210), T204 (= T211), T240 (≠ A247)
- binding phosphate ion: L47 (= L46), D48 (≠ T47), R73 (≠ I72)
Sites not aligning to the query:
8ahuA Crystal structure of d-amino acid aminotrensferase from haliscomenobacter hydrossis complexed with d-cycloserine (see paper)
29% identity, 97% coverage: 1:278/287 of query aligns to 3:272/283 of 8ahuA
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: F35 (≠ Y33), R54 (= R52), R139 (= R142), K145 (= K149), Y149 (≠ L153), E178 (= E182), A180 (= A184), R181 (≠ A185), S182 (≠ T186), L201 (= L207), G203 (= G209), I204 (≠ V210), T205 (= T211), S240 (≠ A246), T241 (≠ A247)
8yrvA Crystal structure of d-amino acid transaminase from haliscomenobacter hydrossis complexed with 3-aminooxypropionic acid
29% identity, 97% coverage: 1:278/287 of query aligns to 3:268/279 of 8yrvA
- binding 3-[(~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]oxypropanoic acid: Y37 (≠ V35), R54 (= R52), R135 (= R142), K141 (= K149), Y145 (≠ L153), E174 (= E182), A176 (= A184), R177 (≠ A185), S178 (≠ T186), N179 (= N187), L197 (= L207), G199 (= G209), I200 (≠ V210), T201 (= T211), T237 (≠ A247), I238 (≠ T248)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
31% identity, 90% coverage: 4:262/287 of query aligns to 17:277/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ Y33), R65 (= R52), N166 (vs. gap), S202 (≠ A185), T203 (= T186), F222 (≠ L207), G224 (= G209), I225 (≠ V210), T226 (= T211), G261 (≠ A246), T262 (≠ A247)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
29% identity, 96% coverage: 6:281/287 of query aligns to 6:288/304 of 1iyeA
- active site: F33 (≠ Y33), G35 (≠ V35), K156 (vs. gap), A157 (vs. gap), E190 (= E182), L214 (= L207)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R52), Y92 (vs. gap), Y126 (≠ G123), K156 (vs. gap), Y161 (≠ L153), E190 (= E182), G193 (≠ A185), E194 (≠ T186), N195 (= N187), L214 (= L207), G216 (= G209), I217 (≠ V210), T218 (= T211), G253 (≠ A246), T254 (≠ A247), A255 (≠ T248)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
29% identity, 96% coverage: 6:281/287 of query aligns to 6:288/304 of 1iydA
- active site: F33 (≠ Y33), G35 (≠ V35), K156 (vs. gap), A157 (vs. gap), E190 (= E182), L214 (= L207)
- binding glutaric acid: Y92 (vs. gap), Y126 (≠ G123), A255 (≠ T248)
- binding pyridoxal-5'-phosphate: R56 (= R52), K156 (vs. gap), Y161 (≠ L153), E190 (= E182), G193 (≠ A185), E194 (≠ T186), L214 (= L207), G216 (= G209), I217 (≠ V210), T218 (= T211), T254 (≠ A247)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
29% identity, 96% coverage: 6:281/287 of query aligns to 6:288/304 of 1i1mA
- active site: K156 (vs. gap)
- binding 4-methyl valeric acid: Y92 (vs. gap), K156 (vs. gap), T254 (≠ A247), A255 (≠ T248)
- binding pyridoxal-5'-phosphate: R56 (= R52), K156 (vs. gap), Y161 (≠ L153), E190 (= E182), G193 (≠ A185), E194 (≠ T186), L214 (= L207), G216 (= G209), I217 (≠ V210), T218 (= T211), G253 (≠ A246), T254 (≠ A247)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
29% identity, 96% coverage: 6:281/287 of query aligns to 6:288/304 of 1i1lA
- active site: K156 (vs. gap)
- binding 2-methylleucine: Y92 (vs. gap), K156 (vs. gap), T254 (≠ A247), A255 (≠ T248)
- binding pyridoxal-5'-phosphate: R56 (= R52), K156 (vs. gap), Y161 (≠ L153), E190 (= E182), G193 (≠ A185), G216 (= G209), I217 (≠ V210), T218 (= T211), T254 (≠ A247)
7dbeB Structure of a novel transaminase
29% identity, 98% coverage: 5:284/287 of query aligns to 41:322/332 of 7dbeB
- binding pyridoxal-5'-phosphate: R88 (= R52), K190 (= K149), E223 (= E182), G226 (≠ A185), F227 (≠ T186), N228 (= N187), L245 (= L207), G247 (= G209), I248 (≠ V210), T249 (= T211), T285 (≠ A247)
6xu3C (R)-selective amine transaminase from shinella sp. (see paper)
28% identity, 97% coverage: 4:280/287 of query aligns to 29:306/322 of 6xu3C
- active site: Y58 (= Y33), K178 (= K149), E211 (= E182), L233 (= L207)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: V60 (= V35), R77 (= R52), K178 (= K149), F185 (≠ N156), E211 (= E182), G214 (≠ A185), N216 (= N187), L233 (= L207), G235 (= G209), V236 (= V210), T237 (= T211), T272 (≠ A246), T273 (≠ A247), A274 (≠ T248)
Query Sequence
>SMc01047 FitnessBrowser__Smeli:SMc01047
MPRIAYVNGTYVRHAEAAIHVEDRGYQFADGVYEVCEVRHGFIIDLTRHLDRLGRSLGEL
RIGWPMSRAALIHVIREVLRRNRVRNGLFYLQVTRGVARRDHVFPDADTPPSIVVTAKRT
DPGAIARKNAEGISAITVPENRWDRVDIKSVGLLPNVLARQQAKEAGAQEAIFVDVDGMV
KEGAATNVWIVDREGTLRTRPAESGILRGVTRTTLMDVAKPLGLAIEETAFSVEEMLAAR
EVFITAATSICFPVVSVDGKTIGNGHPGSIAQNIRETFFDIAEKTVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory