SitesBLAST
Comparing SMc01051 FitnessBrowser__Smeli:SMc01051 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P0AEY3 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Escherichia coli (strain K12) (see paper)
52% identity, 95% coverage: 7:270/277 of query aligns to 4:257/263 of P0AEY3
- R95 (= R98) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K119 (= K122) mutation to A: Does not affect the nucleotide pyrophosphohydrolysis activity.
- K168 (= K183) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KVYEE 168:172 (≠ KVEEE 183:187) binding
- E171 (= E186) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E172 (= E187) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- E175 (= E190) binding ; mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K189 (= K202) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KLEE 189:192 (≠ KVAD 202:205) binding
- E192 (≠ D205) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E193 (= E206) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- D196 (= D209) binding ; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K222 (= K235) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- KFERR 222:226 (≠ KFRRR 235:239) binding
- R226 (= R239) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- W253 (= W266) binding ; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K257 (= K270) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
3crcA Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
47% identity, 94% coverage: 7:267/277 of query aligns to 3:219/225 of 3crcA
Q9X015 Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG; NTP-PPase; EC 3.6.1.1; EC 3.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
41% identity, 97% coverage: 2:271/277 of query aligns to 3:251/255 of Q9X015
- E41 (= E41) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-42.
- E42 (= E42) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-41.
- E45 (= E45) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- E61 (= E61) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- R97 (= R97) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-98.
- R98 (= R98) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-97.
- K118 (= K122) mutation to E: Reduces the NTPase activity to 10% of the wild-type activity.
- E173 (≠ Q193) mutation to A: Has little effects on the NTPase activity.
- E176 (≠ K196) mutation to A: Has little effects on the NTPase activity.
- EE 185:186 (≠ DE 205:206) mutation to AA: Has little effects on the NTPase activity.
3crcB Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
43% identity, 94% coverage: 7:267/277 of query aligns to 3:213/220 of 3crcB
P96379 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 60% coverage: 8:172/277 of query aligns to 85:235/325 of P96379
- A219 (= A156) mutation to E: Pyrophosphohydrolase activity is reduced 20-fold. It affects the magnesium binding and the protein structure.
A0R3C4 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 60% coverage: 8:172/277 of query aligns to 85:238/324 of A0R3C4
- A222 (= A156) mutation to E: Pyrophosphohydrolase activity is reduced 30-fold.
7yh5B Mazg(mycobacterium tuberculosis) (see paper)
44% identity, 33% coverage: 8:98/277 of query aligns to 85:177/177 of 7yh5B
2yxhA Crystal structure of mazg-related protein from thermotoga maritima
29% identity, 42% coverage: 7:123/277 of query aligns to 2:114/114 of 2yxhA
Query Sequence
>SMc01051 FitnessBrowser__Smeli:SMc01051
MEASRDIQRLLDIMAALRDPETGCPWDIVQTFETIRPYTIEEAYEVADAIERHDMDDLCD
ELGDLLLQVVFHARMAEEAGAFSFGDVVEAITRKMIRRHPHVFARSDADTAEAVKLQWEE
IKQAEKADRRQRRLQRGVSQEEHAGHLGSIQRSFPALVEALKLQERAAKVGFDWSEPEPI
LDKVEEEIGELRQALKDGDLGKVADELGDLIFALVNIGRHVGTDPEMALRGTNTKFRRRF
GHIEKELEAGGETLDAASLERMEELWQAAKAIERQLT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory