SitesBLAST
Comparing SMc01103 FitnessBrowser__Smeli:SMc01103 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
40% identity, 100% coverage: 1:299/299 of query aligns to 1:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N181), T217 (= T217), G219 (= G219), A220 (= A220), G222 (= G222), F250 (= F251), N272 (≠ A273), G275 (= G276), A276 (≠ S277), T279 (≠ C280)
- binding magnesium ion: D242 (= D243), T244 (≠ V245), A278 (= A279), S287 (= S288)
2fv7A Crystal structure of human ribokinase
37% identity, 100% coverage: 2:299/299 of query aligns to 4:307/308 of 2fv7A
- active site: G252 (= G246), A253 (= A247), G254 (= G248), D255 (= D249)
- binding adenosine-5'-diphosphate: N185 (= N181), T221 (= T217), G223 (= G219), G226 (= G222), T242 (= T238), V245 (≠ I239), A253 (= A247), G254 (= G248), N281 (≠ A273), A284 (≠ G276), A285 (≠ S277), V288 (≠ C280)
6wjzA Crystal structure of human ribokinase in complex with ampcp
37% identity, 100% coverage: 2:299/299 of query aligns to 5:308/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N181), T222 (= T217), G224 (= G219), A225 (= A220), G227 (= G222), T243 (= T238), V246 (≠ I239), A254 (= A247), G255 (= G248), N282 (≠ A273), A285 (≠ G276), A286 (≠ S277), V289 (≠ C280)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
37% identity, 100% coverage: 2:299/299 of query aligns to 5:308/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T217), G224 (= G219), A225 (= A220), G227 (= G222), T243 (= T238), V246 (≠ I239), A254 (= A247), G255 (= G248), N282 (≠ A273), A285 (≠ G276), A286 (≠ S277), V289 (≠ C280)
- binding alpha-D-ribofuranose: D14 (= D11), G40 (= G37), K41 (= K38), N44 (= N41), A96 (= A92), E141 (= E137), D256 (= D249)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
37% identity, 100% coverage: 2:299/299 of query aligns to 5:308/317 of 5c41A
- active site: G253 (= G246), A254 (= A247), G255 (= G248), D256 (= D249)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T217), G224 (= G219), A225 (= A220), G227 (= G222), V246 (≠ I239), G255 (= G248), N282 (≠ A273), A285 (≠ G276), A286 (≠ S277)
5c3yA Structure of human ribokinase crystallized with amppnp
37% identity, 98% coverage: 2:295/299 of query aligns to 4:303/306 of 5c3yA
- active site: G252 (= G246), A253 (= A247), G254 (= G248), D255 (= D249)
- binding amp phosphoramidate: T221 (= T217), G223 (= G219), V245 (≠ I239), T250 (= T244), G254 (= G248), N281 (≠ A273), A284 (≠ G276), A285 (≠ S277)
5byfA Crystal structure of human ribokinase in complex with amp
37% identity, 98% coverage: 6:299/299 of query aligns to 10:309/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
37% identity, 98% coverage: 6:299/299 of query aligns to 22:321/322 of Q9H477
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
36% identity, 100% coverage: 2:299/299 of query aligns to 4:302/306 of 4xckA
- active site: A249 (≠ G246), A250 (= A247), G251 (= G248), D252 (= D249)
- binding adenosine-5'-diphosphate: T220 (= T217), G222 (= G219), S223 (≠ A220), V242 (≠ I239), T247 (= T244), A250 (= A247), F254 (= F251), H276 (≠ A273), A279 (≠ G276), V283 (≠ C280)
- binding alpha-D-ribofuranose: N11 (= N9), D13 (= D11), G39 (= G37), K40 (= K38), N43 (= N41), A95 (= A92), I107 (= I104), I109 (≠ V106), E140 (= E137), T248 (≠ V245), D252 (= D249)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
39% identity, 100% coverage: 2:299/299 of query aligns to 4:302/305 of 1rk2A
- active site: A249 (≠ G246), A250 (= A247), G251 (= G248), D252 (= D249)
- binding adenosine-5'-diphosphate: T220 (= T217), G222 (= G219), S223 (≠ A220), A250 (= A247), G251 (= G248), H276 (≠ A273), A279 (≠ G276)
- binding tetrafluoroaluminate ion: G213 (≠ T210), R215 (≠ Q212)
- binding magnesium ion: D246 (= D243), A282 (= A279), R285 (≠ K282), S291 (= S288)
- binding alpha-D-ribofuranose: N11 (= N9), D13 (= D11), G38 (= G36), G39 (= G37), K40 (= K38), N43 (= N41), E140 (= E137), D252 (= D249)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 100% coverage: 2:299/299 of query aligns to 7:305/309 of P0A9J6
1gqtB Activation of ribokinase by monovalent cations (see paper)
39% identity, 100% coverage: 2:299/299 of query aligns to 6:304/307 of 1gqtB
- active site: A251 (≠ G246), A252 (= A247), G253 (= G248), D254 (= D249)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N181), T222 (= T217), G224 (= G219), S225 (≠ A220), A252 (= A247), G253 (= G248), H278 (≠ A273), A281 (≠ G276)
- binding cesium ion: D248 (= D243), I250 (≠ V245), A284 (= A279), R287 (≠ K282), S293 (= S288)
- binding alpha-D-ribofuranose: N13 (= N9), D15 (= D11), G41 (= G37), N45 (= N41), E142 (= E137), D254 (= D249)
6znxC Ribokinase from thermus species
36% identity, 100% coverage: 1:299/299 of query aligns to 1:263/265 of 6znxC
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
34% identity, 97% coverage: 2:290/299 of query aligns to 5:300/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N181), K225 (≠ T217), G227 (= G219), I246 (≠ G236), A248 (≠ T238), A257 (= A247), G258 (= G248), F261 (= F251), A286 (≠ G276), S287 (= S277)
- binding alpha-D-ribofuranose: N12 (= N9), D14 (= D11), G40 (= G37), K41 (= K38), N44 (= N41), E144 (= E137), D259 (= D249)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 97% coverage: 2:290/299 of query aligns to 71:366/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
34% identity, 99% coverage: 4:299/299 of query aligns to 8:320/320 of 6xk2A
6a8cA Ribokinase from leishmania donovani with adp (see paper)
30% identity, 99% coverage: 2:297/299 of query aligns to 16:324/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G219), A246 (= A220), T271 (= T244), A274 (= A247), G275 (= G248), N300 (≠ A273), A303 (≠ G276)
- binding glycerol: D25 (= D11), S42 (≠ G28), S44 (≠ D30), G50 (= G36), G51 (= G37), N55 (= N41)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
30% identity, 99% coverage: 2:297/299 of query aligns to 16:324/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G219), A246 (= A220), T271 (= T244), A274 (= A247), G275 (= G248), N300 (≠ A273), A303 (≠ G276), V307 (≠ C280)
- binding glycerol: D25 (= D11), G50 (= G36), G51 (= G37), N55 (= N41), N157 (≠ L136), I159 (= I138), E190 (≠ R170)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
30% identity, 99% coverage: 2:297/299 of query aligns to 16:324/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N181), T243 (= T217), G245 (= G219), A246 (= A220), G248 (= G222), T271 (= T244), G273 (= G246), A274 (= A247), G275 (= G248), N300 (≠ A273), A303 (≠ G276), V307 (≠ C280)
- binding glycerol: D25 (= D11), G50 (= G36), G51 (= G37), N55 (= N41)
3go6B Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
37% identity, 95% coverage: 2:284/299 of query aligns to 4:269/287 of 3go6B
- active site: G227 (= G246), A228 (= A247), G229 (= G248), D230 (= D249)
- binding adenosine-5'-diphosphate: G200 (= G219), V201 (≠ A220), G203 (= G222), V220 (≠ I239), T225 (= T244), A228 (= A247), G229 (= G248), C258 (≠ A273), G261 (= G276), A262 (≠ S277), T265 (≠ C280)
- binding magnesium ion: D224 (= D243), A226 (≠ V245), A264 (= A279), V267 (≠ K282), G269 (= G284)
Sites not aligning to the query:
Query Sequence
>SMc01103 FitnessBrowser__Smeli:SMc01103
MITVFGSINMDLIATTARLPKPGETVAGTDFSTAAGGKGANQALAARRAGASVRMAGAVG
SDAFAEGALALLKEAGTDLDLTKTVGEPTGTAHIIVGGDGENVIVVVASANARVSGDDAA
NVVAQMSAGDTLMLQLEIPSASVEKALSEAKRRGIRSIINIAPLTPDAARLGRMADIVIA
NETEFELLAGKAGIAGAEREEAMNGLHAETRQTVIVTLGAEGVVAIHEGELHRAKGLTIE
PVDTVGAGDTFCGYLAAGLDAGLAFSEALRRAAIAGSLACLKPGAQPSIPLAAEVAARL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory