Comparing SMc01141 FitnessBrowser__Smeli:SMc01141 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
31% identity, 94% coverage: 3:147/154 of query aligns to 502:648/650 of O31645
Sites not aligning to the query:
P46321 Probable licABCH operon regulator; EC 2.7.1.- from Bacillus subtilis (strain 168) (see paper)
30% identity, 69% coverage: 20:125/154 of query aligns to 514:615/641 of P46321
Sites not aligning to the query:
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
24% identity, 71% coverage: 37:146/154 of query aligns to 33:142/144 of 1j6tA
>SMc01141 FitnessBrowser__Smeli:SMc01141
MALAGLLHQNAIIPAMRANSKKQLLQELAAKASKLTGLPEREIFDVILQRERLGSTGVGN
GIAIPHGKLSNLPSIVGIFARLDAPVDFEALDDQPVDLVFLLLAPEGAGADHLKALSRIA
RVLRDHDMVSRIRASDSASAIYTLLSDDTTSHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory