Comparing SMc01165 FitnessBrowser__Smeli:SMc01165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 47% coverage: 18:320/650 of query aligns to 2:279/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 47% coverage: 18:320/650 of query aligns to 2:279/300 of 1v1bA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 47% coverage: 18:320/650 of query aligns to 2:279/309 of Q53W83
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 43% coverage: 22:301/650 of query aligns to 5:255/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 43% coverage: 22:301/650 of query aligns to 4:254/302 of 3gbuA
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
27% identity, 49% coverage: 24:343/650 of query aligns to 8:306/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
27% identity, 49% coverage: 24:343/650 of query aligns to 12:310/310 of 5yggA
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
28% identity, 50% coverage: 20:342/650 of query aligns to 3:305/308 of 2dcnA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 50% coverage: 18:343/650 of query aligns to 2:309/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
25% identity, 50% coverage: 18:343/650 of query aligns to 1:308/311 of 2varA
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 51% coverage: 23:351/650 of query aligns to 10:316/319 of Q8ZKR2
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
25% identity, 47% coverage: 20:325/650 of query aligns to 4:288/308 of 3iq0B
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
26% identity, 50% coverage: 22:343/650 of query aligns to 5:297/297 of 1tz6A
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
26% identity, 50% coverage: 22:343/650 of query aligns to 5:297/299 of 1tz3A
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
25% identity, 47% coverage: 18:323/650 of query aligns to 2:289/312 of 3in1A
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
22% identity, 50% coverage: 19:344/650 of query aligns to 4:338/338 of 3uboA
F4I0K2 Fructokinase-like 2, chloroplastic; pfkB-type carbohydrate kinase family protein 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
21% identity, 33% coverage: 20:232/650 of query aligns to 217:420/614 of F4I0K2
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
24% identity, 50% coverage: 20:347/650 of query aligns to 5:322/322 of 3lkiB
6a8cA Ribokinase from leishmania donovani with adp (see paper)
22% identity, 51% coverage: 8:338/650 of query aligns to 4:322/327 of 6a8cA
Q9M394 Fructokinase-like 1, chloroplastic; PEP-associated protein 6; pfkB-type carbohydrate kinase family protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 25% coverage: 29:188/650 of query aligns to 128:286/471 of Q9M394
Sites not aligning to the query:
>SMc01165 FitnessBrowser__Smeli:SMc01165
MSQIPSAQVPSGAGAKPLDLITIGRASVDLYGQQIGTRLEDVASFAKSVGGCPCNISVGT
ARLGLKSALLTRVGDEQMGRFIREQLQREGVETRGIVTDPERLTALAILSVENDKSFPLL
FYRDNCADNALCEDDISEDFIRSARAVLVTGTHFAKPNADAAQRKAIRIAKESGARIVFD
IDYRPNLWGLAGHDAGESRYIASDRVSAHLKTVLGDCDLIVGTEEEVLIASGESDLLAAL
KTIRSLSKATIVLKRGPMGCIVYDGPISDDLEDGIVGKGFPIEVYNVLGAGDAFMSGFLR
GWLTGEPHATSATWANACGAFAVSRLLCAPEIPTWTELQYFLEHGSKEKALRKDEAINHV
HWATTRRRDIPLLMALAVDHRSQLEDIAEGNPELLSRIPAFKVLAVKAAAEVAQGRSGFG
MLIDDKYGRDALYAAGAHRDFWIGKPIELPGSRPLTFEFSQDLGSRLVDWPVDHCIKVLS
FYHPDDPAELKAAQVAKLRSAFEAARKVGREILIEIIAGKHGKLDDRTIPRALEELYDAG
LKPDWWKLEPQASRAAWAAIDAVIETRDPLCRGVVLLGLEAPYEVLKDGFAAARTSKTVK
GFAVGRTIFADAAKAWLAGRMTDEQAVSDMAAKFKALVDLWLQLGETKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory