SitesBLAST
Comparing SMc01166 FitnessBrowser__Smeli:SMc01166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 1:585/595 of 1t9bB
- active site: Y29 (≠ H42), G31 (vs. gap), G32 (= G43), A33 (≠ N44), I34 (≠ V45), E55 (= E67), T78 (= T90), F117 (≠ L131), Q118 (= Q132), E119 (≠ Q133), K167 (≠ Q190), R226 (≠ A249), M262 (≠ V285), V289 (≠ T312), V405 (≠ A419), L430 (≠ F444), G431 (≠ S445), M433 (= M447), D458 (= D472), N485 (= N499), E487 (≠ G501), Q488 (≠ Y502), M490 (≠ C504), V491 (≠ I505), W494 (≠ L508), L516 (≠ H537), G521 (= G542), L522 (≠ A543), K555 (vs. gap)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V121), P108 (≠ F122), D287 (= D310), R288 (≠ F311), M490 (≠ C504), W494 (≠ L508)
- binding flavin-adenine dinucleotide: R157 (≠ D180), G215 (= G239), A216 (≠ G240), G217 (= G241), N220 (vs. gap), T242 (= T265), L243 (≠ Q266), Q244 (≠ A267), M259 (≠ S282), L260 (≠ V283), M262 (≠ V285), H263 (≠ T286), G282 (= G305), A283 (≠ S306), R284 (= R307), D286 (≠ Q309), R288 (≠ F311), V289 (≠ T312), E315 (≠ N330), V316 (= V331), N320 (≠ D335), G333 (≠ S346), D334 (= D347), A335 (= A348), Q409 (≠ K428), M410 (≠ L429), G428 (≠ Y442), G429 (= G443)
- binding magnesium ion: D458 (= D472), N485 (= N499), E487 (≠ G501)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 2:587/597 of 1t9aA
- active site: Y30 (≠ H42), G32 (vs. gap), G33 (= G43), A34 (≠ N44), I35 (≠ V45), E56 (= E67), T79 (= T90), F118 (≠ L131), Q119 (= Q132), E120 (≠ Q133), K168 (≠ Q190), R228 (≠ A249), M264 (≠ V285), V291 (≠ T312), V407 (≠ A419), L432 (≠ F444), G433 (≠ S445), M435 (= M447), D460 (= D472), N487 (= N499), E489 (≠ G501), Q490 (≠ Y502), M492 (≠ C504), V493 (≠ I505), W496 (≠ L508), L518 (≠ H537), G523 (= G542), L524 (≠ A543), K557 (vs. gap)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G43), V108 (= V121), P109 (≠ F122), F118 (≠ L131), K168 (≠ Q190), M264 (≠ V285), D289 (= D310), R290 (≠ F311), M492 (≠ C504), V493 (≠ I505), W496 (≠ L508)
- binding flavin-adenine dinucleotide: R158 (≠ D180), G217 (= G239), A218 (≠ G240), G219 (= G241), N222 (vs. gap), T244 (= T265), L245 (≠ Q266), Q246 (≠ A267), L262 (≠ V283), M264 (≠ V285), H265 (≠ T286), G284 (= G305), A285 (≠ S306), R286 (= R307), D288 (≠ Q309), R290 (≠ F311), V291 (≠ T312), E317 (≠ N330), V318 (= V331), N322 (≠ D335), G335 (≠ S346), D336 (= D347), A337 (= A348), Q411 (≠ K428), M412 (≠ L429), G430 (≠ Y442), G431 (= G443)
- binding magnesium ion: D460 (= D472), N487 (= N499), E489 (≠ G501)
- binding propyl trihydrogen diphosphate: V407 (≠ A419), G408 (= G420), Q409 (≠ G421), H410 (= H427), M435 (= M447), G459 (= G471), D460 (= D472), A461 (≠ G473), S462 (= S474), N487 (= N499), E489 (≠ G501), Q490 (≠ Y502), G491 (= G503), M492 (≠ C504)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (≠ S445), M435 (= M447), M465 (= M477)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 1:586/596 of 1t9dA
- active site: Y29 (≠ H42), G31 (vs. gap), G32 (= G43), A33 (≠ N44), I34 (≠ V45), E55 (= E67), T78 (= T90), F117 (≠ L131), Q118 (= Q132), E119 (≠ Q133), K167 (≠ Q190), R227 (≠ A249), M263 (≠ V285), V290 (≠ T312), V406 (≠ A419), L431 (≠ F444), G432 (≠ S445), M434 (= M447), D459 (= D472), N486 (= N499), E488 (≠ G501), Q489 (≠ Y502), M491 (≠ C504), V492 (≠ I505), W495 (≠ L508), L517 (≠ H537), G522 (= G542), L523 (≠ A543), K556 (vs. gap)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G43), A33 (≠ N44), V107 (= V121), P108 (≠ F122), F117 (≠ L131), K167 (≠ Q190), M263 (≠ V285), D288 (= D310), R289 (≠ F311), W495 (≠ L508)
- binding flavin-adenine dinucleotide: R157 (≠ D180), G216 (= G239), A217 (≠ G240), G218 (= G241), N221 (vs. gap), T243 (= T265), L244 (≠ Q266), Q245 (≠ A267), M260 (≠ S282), L261 (≠ V283), H264 (≠ T286), G283 (= G305), A284 (≠ S306), R285 (= R307), D287 (≠ Q309), R289 (≠ F311), V290 (≠ T312), E316 (≠ N330), V317 (= V331), N321 (≠ D335), G334 (≠ S346), D335 (= D347), A336 (= A348), Q410 (≠ K428), M411 (≠ L429), G429 (≠ Y442), G430 (= G443)
- binding magnesium ion: D459 (= D472), N486 (= N499), E488 (≠ G501)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E67), P81 (= P95), Q118 (= Q132), G432 (≠ S445), M434 (= M447), M464 (= M477)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 1:586/596 of 1t9cA
- active site: Y29 (≠ H42), G31 (vs. gap), G32 (= G43), A33 (≠ N44), I34 (≠ V45), E55 (= E67), T78 (= T90), F117 (≠ L131), Q118 (= Q132), E119 (≠ Q133), K167 (≠ Q190), R227 (≠ A249), M263 (≠ V285), V290 (≠ T312), V406 (≠ A419), L431 (≠ F444), G432 (≠ S445), M434 (= M447), D459 (= D472), N486 (= N499), E488 (≠ G501), Q489 (≠ Y502), M491 (≠ C504), V492 (≠ I505), W495 (≠ L508), L517 (≠ H537), G522 (= G542), L523 (≠ A543), K556 (vs. gap)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G43), V107 (= V121), P108 (≠ F122), F117 (≠ L131), K167 (≠ Q190), D288 (= D310), R289 (≠ F311), W495 (≠ L508)
- binding flavin-adenine dinucleotide: R157 (≠ D180), G216 (= G239), A217 (≠ G240), G218 (= G241), N221 (vs. gap), T243 (= T265), L244 (≠ Q266), Q245 (≠ A267), L261 (≠ V283), M263 (≠ V285), H264 (≠ T286), G283 (= G305), A284 (≠ S306), R285 (= R307), D287 (≠ Q309), R289 (≠ F311), V290 (≠ T312), E316 (≠ N330), V317 (= V331), N321 (≠ D335), G334 (≠ S346), D335 (= D347), A336 (= A348), M411 (≠ L429), G429 (≠ Y442), G430 (= G443)
- binding magnesium ion: D459 (= D472), N486 (= N499), E488 (≠ G501)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 1:573/583 of 1t9bA
- active site: Y29 (≠ H42), G31 (vs. gap), G32 (= G43), A33 (≠ N44), I34 (≠ V45), E55 (= E67), T78 (= T90), F117 (≠ L131), Q118 (= Q132), E119 (≠ Q133), K167 (≠ Q190), R214 (≠ A249), M250 (≠ V285), V277 (≠ T312), V393 (≠ A419), L418 (≠ F444), G419 (≠ S445), M421 (= M447), D446 (= D472), N473 (= N499), E475 (≠ G501), Q476 (≠ Y502), M478 (≠ C504), V479 (≠ I505), W482 (≠ L508), L504 (≠ H537), G509 (= G542), L510 (≠ A543), K543 (vs. gap)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V121), P108 (≠ F122), F117 (≠ L131), D275 (= D310), R276 (≠ F311), M478 (≠ C504), W482 (≠ L508)
- binding flavin-adenine dinucleotide: R157 (≠ D180), G203 (= G239), A204 (≠ G240), G205 (= G241), N208 (vs. gap), T230 (= T265), L231 (≠ Q266), Q232 (≠ A267), M247 (≠ S282), L248 (≠ V283), M250 (≠ V285), H251 (≠ T286), G270 (= G305), A271 (≠ S306), R272 (= R307), D274 (≠ Q309), R276 (≠ F311), V277 (≠ T312), E303 (≠ N330), V304 (= V331), N308 (≠ D335), D322 (= D347), A323 (= A348), Q397 (≠ K428), M398 (≠ L429), G416 (≠ Y442), G417 (= G443)
- binding magnesium ion: D446 (= D472), N473 (= N499), E475 (≠ G501)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
24% identity, 87% coverage: 65:601/617 of query aligns to 52:572/582 of 1t9dB
- active site: E54 (= E67), T77 (= T90), F116 (≠ L131), Q117 (= Q132), E118 (≠ Q133), K166 (≠ Q190), R213 (≠ A249), M249 (≠ V285), V276 (≠ T312), V392 (≠ A419), L417 (≠ F444), G418 (≠ S445), M420 (= M447), D445 (= D472), N472 (= N499), E474 (≠ G501), Q475 (≠ Y502), M477 (≠ C504), V478 (≠ I505), W481 (≠ L508), L503 (≠ H537), G508 (= G542), L509 (≠ A543), K542 (vs. gap)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: V106 (= V121), P107 (≠ F122), F116 (≠ L131), K166 (≠ Q190), M249 (≠ V285), D274 (= D310), R275 (≠ F311), W481 (≠ L508)
- binding flavin-adenine dinucleotide: R156 (≠ D180), G202 (= G239), A203 (≠ G240), G204 (= G241), N207 (vs. gap), T229 (= T265), L230 (≠ Q266), Q231 (≠ A267), L247 (≠ V283), M249 (≠ V285), H250 (≠ T286), G269 (= G305), A270 (≠ S306), R271 (= R307), D273 (≠ Q309), R275 (≠ F311), V276 (≠ T312), E302 (≠ N330), V303 (= V331), N307 (≠ D335), G320 (≠ S346), D321 (= D347), A322 (= A348), Q396 (≠ K428), M397 (≠ L429), G415 (≠ Y442), G416 (= G443)
- binding magnesium ion: D445 (= D472), N472 (= N499), E474 (≠ G501)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E67), P80 (= P95), G418 (≠ S445), M420 (= M447), M450 (= M477)
Sites not aligning to the query:
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 1:581/591 of 5wkcA
- active site: Y29 (≠ H42), G31 (vs. gap), G32 (= G43), A33 (≠ N44), I34 (≠ V45), E55 (= E67), T78 (= T90), F117 (≠ L131), Q118 (= Q132), E119 (≠ Q133), K167 (≠ Q190), R222 (≠ A249), M258 (≠ V285), V285 (≠ T312), V401 (≠ A419), L426 (≠ F444), G427 (≠ S445), M429 (= M447), D454 (= D472), N481 (= N499), E483 (≠ G501), Q484 (≠ Y502), M486 (≠ C504), V487 (≠ I505), W490 (≠ L508), L512 (≠ H537), G517 (= G542), L518 (≠ A543), K551 (vs. gap)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (≠ A419), G402 (= G420), Q403 (≠ G421), H404 (= H427), G427 (≠ S445), M429 (= M447), G453 (= G471), D454 (= D472), A455 (≠ G473), S456 (= S474), M459 (= M477), N481 (= N499), E483 (≠ G501), Q484 (≠ Y502), G485 (= G503), M486 (≠ C504), V487 (≠ I505)
- binding ethaneperoxoic acid: G32 (= G43), Q118 (= Q132)
- binding flavin-adenine dinucleotide: R157 (≠ D180), G211 (= G239), A212 (≠ G240), G213 (= G241), N216 (vs. gap), T238 (= T265), L239 (≠ Q266), Q240 (≠ A267), L256 (≠ V283), M258 (≠ V285), G278 (= G305), A279 (≠ S306), R280 (= R307), R284 (≠ F311), V285 (≠ T312), E311 (≠ N330), V312 (= V331), N316 (≠ D335), D330 (= D347), A331 (= A348), M406 (≠ L429), G424 (≠ Y442)
- binding magnesium ion: D454 (= D472), N481 (= N499), E483 (≠ G501)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G43), A33 (≠ N44), V107 (= V121), F117 (≠ L131), K167 (≠ Q190), M258 (≠ V285), R284 (≠ F311), M486 (≠ C504), W490 (≠ L508)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (vs. gap), E55 (= E67)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 3:589/599 of 1n0hA
- active site: Y31 (≠ H42), G33 (vs. gap), G34 (= G43), A35 (≠ N44), I36 (≠ V45), E57 (= E67), T80 (= T90), F119 (≠ L131), Q120 (= Q132), E121 (≠ Q133), K169 (≠ Q190), R230 (≠ A249), M266 (≠ V285), V293 (≠ T312), V409 (≠ A419), L434 (≠ F444), G435 (≠ S445), M437 (= M447), D462 (= D472), N489 (= N499), E491 (≠ G501), Q492 (≠ Y502), M494 (≠ C504), V495 (≠ I505), W498 (≠ L508), L520 (≠ H537), G525 (= G542), L526 (≠ A543), K559 (vs. gap)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ A419), G410 (= G420), Q411 (≠ G421), H412 (= H427), G435 (≠ S445), M437 (= M447), G461 (= G471), D462 (= D472), A463 (≠ G473), S464 (= S474), M467 (= M477), N489 (= N499), E491 (≠ G501), Q492 (≠ Y502), G493 (= G503), V495 (≠ I505)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G43), A35 (≠ N44), V109 (= V121), P110 (≠ F122), F119 (≠ L131), K169 (≠ Q190), M266 (≠ V285), D291 (= D310), R292 (≠ F311), V495 (≠ I505), W498 (≠ L508)
- binding flavin-adenine dinucleotide: R159 (≠ D180), G219 (= G239), A220 (≠ G240), G221 (= G241), N224 (vs. gap), T246 (= T265), L247 (≠ Q266), Q248 (≠ A267), L264 (≠ V283), G265 (= G284), M266 (≠ V285), H267 (≠ T286), G286 (= G305), A287 (≠ S306), R288 (= R307), D290 (≠ Q309), R292 (≠ F311), V293 (≠ T312), E319 (≠ N330), V320 (= V331), N324 (≠ D335), G337 (≠ S346), D338 (= D347), A339 (= A348), M414 (≠ L429), G432 (≠ Y442), G433 (= G443)
- binding magnesium ion: D462 (= D472), N489 (= N499), E491 (≠ G501)
- binding thiamine diphosphate: Y31 (≠ H42), E57 (= E67), P83 (= P95)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 5:597/607 of 6u9dB
- active site: Y33 (≠ H42), G35 (vs. gap), G36 (= G43), A37 (≠ N44), I38 (≠ V45), E59 (= E67), T82 (= T90), F121 (≠ L131), Q122 (= Q132), E123 (≠ Q133), K171 (≠ Q190), M274 (≠ V285), V301 (≠ T312), V417 (≠ A419), G443 (≠ S445), M445 (= M447), D470 (= D472), N497 (= N499), E499 (≠ G501), Q500 (≠ Y502), M502 (≠ C504), V503 (≠ I505), W506 (≠ L508)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G43), V111 (= V121), P112 (≠ F122), F121 (≠ L131), K171 (≠ Q190), D299 (= D310), R300 (≠ F311), M502 (≠ C504), W506 (≠ L508)
- binding flavin-adenine dinucleotide: R161 (≠ D180), A228 (≠ G240), G229 (= G241), N232 (vs. gap), T254 (= T265), L255 (≠ Q266), Q256 (≠ A267), L272 (≠ V283), M274 (≠ V285), G294 (= G305), R296 (= R307), D298 (≠ Q309), R300 (≠ F311), V301 (≠ T312), E327 (≠ N330), V328 (= V331), N332 (≠ D335), D346 (= D347), A347 (= A348), M422 (≠ L429), G440 (≠ Y442), G441 (= G443)
- binding magnesium ion: D470 (= D472), N497 (= N499)
- binding thiamine diphosphate: E59 (= E67), P85 (= P95), V417 (≠ A419), G418 (= G420), Q419 (≠ G421), H420 (= H427), G443 (≠ S445), M445 (= M447), A471 (≠ G473), S472 (= S474), N497 (= N499), E499 (≠ G501), Q500 (≠ Y502), G501 (= G503), M502 (≠ C504), V503 (≠ I505)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 97% coverage: 1:601/617 of query aligns to 85:677/687 of P07342
- R241 (≠ D180) binding
- 355:376 (vs. 286:307, 36% identical) binding
- 407:426 (vs. 330:347, 15% identical) binding
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
26% identity, 73% coverage: 55:505/617 of query aligns to 130:565/664 of P09114
- P191 (≠ N124) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
Sites not aligning to the query:
- 568 W→L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
6bd9A Saccharomyces cerevisiae acetohydroxyacid synthase
23% identity, 91% coverage: 1:560/617 of query aligns to 3:525/542 of 6bd9A
- active site: Y31 (≠ H42), G33 (vs. gap), G34 (= G43), A35 (≠ N44), I36 (≠ V45), E57 (= E67), T80 (= T90), F119 (≠ L131), Q120 (= Q132), E121 (≠ Q133), K169 (≠ Q190), R228 (≠ A249), M264 (≠ V285), V291 (≠ T312), V407 (≠ A419), L432 (≠ F444), G433 (≠ S445), M435 (= M447), D460 (= D472), N487 (= N499), E489 (≠ D523), L502 (≠ H537), G507 (= G542), L508 (≠ A543)
- binding flavin-adenine dinucleotide: R159 (≠ D180), G217 (= G239), A218 (≠ G240), G219 (= G241), N222 (vs. gap), T244 (= T265), L245 (≠ Q266), L262 (≠ V283), G263 (= G284), H265 (≠ T286), G284 (= G305), A285 (≠ S306), R286 (= R307), D288 (≠ Q309), R290 (≠ F311), V291 (≠ T312), E317 (≠ N330), V318 (= V331), N322 (≠ D335), G335 (≠ S346), D336 (= D347), A337 (= A348)
- binding magnesium ion: D460 (= D472), N487 (= N499)
- binding oxygen molecule: G34 (= G43), T80 (= T90), Q120 (= Q132), A461 (≠ G473), Q494 (≠ E528)
- binding pyruvic acid: G33 (vs. gap), G34 (= G43), G34 (= G43), A35 (≠ N44), Q120 (= Q132)
- binding thiamine diphosphate: P32 (vs. gap), E57 (= E67), V407 (≠ A419), G408 (= G420), Q409 (≠ G421), H410 (= H427), G433 (≠ S445), M435 (= M447), G459 (= G471), D460 (= D472), A461 (≠ G473), S462 (= S474), M465 (= M477), N487 (= N499)
Sites not aligning to the query:
6bd3A Saccharomyces cerevisiae acetohydroxyacid synthase
24% identity, 91% coverage: 1:560/617 of query aligns to 3:521/538 of 6bd3A
- active site: Y31 (≠ H42), G33 (vs. gap), G34 (= G43), A35 (≠ N44), I36 (≠ V45), E57 (= E67), T80 (= T90), F119 (≠ L131), Q120 (= Q132), E121 (≠ Q133), K169 (≠ Q190), R225 (≠ A249), M261 (≠ V285), V288 (≠ T312), V404 (≠ A419), L429 (≠ F444), G430 (≠ S445), M432 (= M447), D457 (= D472), N484 (= N499), L498 (≠ H537), G503 (= G542), L504 (≠ A543)
- binding flavin-adenine dinucleotide: R159 (≠ D180), G214 (= G239), A215 (≠ G240), G216 (= G241), N219 (vs. gap), T241 (= T265), L242 (≠ Q266), Q243 (≠ A267), L259 (≠ V283), G260 (= G284), H262 (≠ T286), G281 (= G305), A282 (≠ S306), R283 (= R307), D285 (≠ Q309), R287 (≠ F311), V288 (≠ T312), E314 (≠ N330), V315 (= V331), D333 (= D347), A334 (= A348)
- binding 2-acetyl-thiamine diphosphate: P32 (vs. gap), E57 (= E67), P83 (= P95)
- binding magnesium ion: D457 (= D472), N484 (= N499)
- binding oxygen molecule: A35 (≠ N44), T80 (= T90), S81 (≠ T91), Q120 (= Q132)
- binding thiamine diphosphate: V404 (≠ A419), G405 (= G420), Q406 (≠ G421), H407 (= H427), G430 (≠ S445), M432 (= M447), D457 (= D472), A458 (≠ G473), S459 (= S474), M462 (= M477), N484 (= N499)
Sites not aligning to the query:
5imsA Saccharomyces cerevisiae acetohydroxyacid synthase
23% identity, 91% coverage: 1:560/617 of query aligns to 3:525/541 of 5imsA
- active site: Y31 (≠ H42), G33 (vs. gap), G34 (= G43), A35 (≠ N44), I36 (≠ V45), E57 (= E67), T80 (= T90), F119 (≠ L131), Q120 (= Q132), E121 (≠ Q133), K169 (≠ Q190), R229 (≠ A249), M265 (≠ V285), V292 (≠ T312), V408 (≠ A419), L433 (≠ F444), G434 (≠ S445), M436 (= M447), D461 (= D472), N488 (= N499), E490 (≠ G501), L502 (≠ H537), G507 (= G542), L508 (≠ A543)
- binding flavin-adenine dinucleotide: R159 (≠ D180), G218 (= G239), A219 (≠ G240), G220 (= G241), N223 (vs. gap), T245 (= T265), L246 (≠ Q266), L263 (≠ V283), G264 (= G284), H266 (≠ T286), G285 (= G305), A286 (≠ S306), R287 (= R307), D289 (≠ Q309), R291 (≠ F311), V292 (≠ T312), E318 (≠ N330), V319 (= V331), N323 (≠ D335), D337 (= D347), A338 (= A348)
- binding magnesium ion: D461 (= D472), N488 (= N499)
- binding oxygen molecule: G34 (= G43), T80 (= T90), Q120 (= Q132)
- binding thiamine diphosphate: P32 (vs. gap), E57 (= E67), V408 (≠ A419), G409 (= G420), Q410 (≠ G421), H411 (= H427), G434 (≠ S445), M436 (= M447), G460 (= G471), D461 (= D472), A462 (≠ G473), S463 (= S474), M466 (= M477), N488 (= N499)
Sites not aligning to the query:
1jscA Crystal structure of the catalytic subunit of yeast acetohydroxyacid synthase: a target for herbicidal inhibitors (see paper)
23% identity, 91% coverage: 1:560/617 of query aligns to 3:524/541 of 1jscA
- active site: Y31 (≠ H42), G33 (vs. gap), G34 (= G43), A35 (≠ N44), I36 (≠ V45), E57 (= E67), T80 (= T90), F119 (≠ L131), Q120 (= Q132), E121 (≠ Q133), K169 (≠ Q190), M263 (≠ V285), V290 (≠ T312), V406 (≠ A419), G432 (≠ S445), M434 (= M447), D459 (= D472), N486 (= N499), E488 (≠ D523)
- binding dihydrogenphosphate ion: G33 (vs. gap), G34 (= G43), Q120 (= Q132)
- binding flavin-adenine dinucleotide: R159 (≠ D180), G216 (= G239), A217 (≠ G240), G218 (= G241), N221 (vs. gap), T243 (= T265), L244 (≠ Q266), L261 (≠ V283), G262 (= G284), H264 (≠ T286), G283 (= G305), A284 (≠ S306), R285 (= R307), D287 (≠ Q309), R289 (≠ F311), V290 (≠ T312), E316 (≠ N330), V317 (= V331), N321 (≠ D335), G334 (≠ S346), D335 (= D347), A336 (= A348)
- binding magnesium ion: D459 (= D472), N486 (= N499)
- binding thiamine diphosphate: Y31 (≠ H42), P32 (vs. gap), E57 (= E67), P83 (= P95), V406 (≠ A419), G407 (= G420), Q408 (≠ G421), H409 (= H427), M434 (= M447), D459 (= D472), A460 (≠ G473), S461 (= S474), N486 (= N499)
Sites not aligning to the query:
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
27% identity, 75% coverage: 36:499/617 of query aligns to 24:478/551 of 6wo1A
- active site: Y30 (≠ H42), G32 (vs. gap), G33 (= G43), A34 (≠ N44), I35 (≠ V45), E56 (= E67), T79 (= T90), F118 (≠ L131), Q119 (= Q132), E120 (≠ Q133), K168 (≠ Q190), M255 (≠ V285), V282 (≠ T312), V398 (≠ A419), G424 (≠ S445), M426 (= M447), D451 (= D472), N478 (= N499)
- binding 2-methylpyrimidin-4-amine: G424 (≠ S445), T425 (= T446), M426 (= M447)
- binding diphosphate: V398 (≠ A419), G399 (= G420), Q400 (≠ G421), H401 (= H427), G450 (= G471), D451 (= D472), A452 (≠ G473), S453 (= S474)
- binding flavin-adenine dinucleotide: D97 (≠ N110), R158 (≠ D180), G208 (= G239), G210 (= G241), S213 (≠ Y244), T235 (= T265), L236 (≠ Q266), Q237 (≠ A267), I253 (≠ V283), G254 (= G284), M255 (≠ V285), G275 (= G305), V276 (≠ S306), R277 (= R307), D279 (≠ Q309), R281 (≠ F311), V282 (≠ T312), E308 (≠ N330), I309 (≠ V331), D327 (= D347), V328 (≠ A348), Q402 (≠ K428), G421 (≠ Y442), G422 (= G443)
- binding magnesium ion: D451 (= D472), N478 (= N499)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
25% identity, 73% coverage: 55:505/617 of query aligns to 51:486/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ V285), R292 (≠ F311)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (= H427), G426 (≠ S445), M428 (= M447), G452 (= G471), D453 (= D472), G454 (= G473), S455 (= S474), L483 (≠ Y502), G484 (= G503), M485 (≠ C504), V486 (≠ I505)
- binding flavin-adenine dinucleotide: R161 (≠ D180), G222 (= G239), G223 (= G240), G224 (= G241), T246 (= T265), L247 (≠ Q266), M248 (≠ A267), M263 (≠ S282), L264 (≠ V283), M266 (≠ V285), H267 (≠ T286), G286 (= G305), R288 (= R307), V293 (≠ T312), D310 (≠ N330), I311 (≠ V331), D329 (vs. gap), V330 (≠ I345), M405 (≠ L429), G423 (≠ Y442)
- binding magnesium ion: T82 (≠ S92), S83 (≠ I93), Q122 (≠ K149), Y381 (≠ A398), D453 (= D472), M458 (= M477), Q461 (≠ S480), N480 (= N499), H482 (≠ G501)
Sites not aligning to the query:
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
25% identity, 73% coverage: 55:505/617 of query aligns to 51:486/583 of 5k3sA
- active site: E59 (= E67), T82 (≠ S92), F121 (= F148), Q122 (≠ K149), E123 (vs. gap), K171 (≠ Q190), M266 (≠ V285), V293 (≠ T312), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D472), N480 (= N499), H482 (≠ G501), L483 (≠ Y502), M485 (≠ C504), V486 (≠ I505)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ F311), M485 (≠ C504)
- binding flavin-adenine dinucleotide: R161 (≠ D180), G222 (= G239), G223 (= G240), G224 (= G241), T246 (= T265), L247 (≠ Q266), M248 (≠ A267), L264 (≠ V283), M266 (≠ V285), G286 (= G305), R288 (= R307), D290 (≠ Q309), V293 (≠ T312), D310 (≠ N330), I311 (≠ V331), D329 (vs. gap), V330 (≠ I345), M405 (≠ L429), G423 (≠ Y442)
- binding magnesium ion: D453 (= D472), N480 (= N499), H482 (≠ G501)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (= H427), G426 (≠ S445), M428 (= M447), D453 (= D472), G454 (= G473), S455 (= S474), N480 (= N499), H482 (≠ G501), L483 (≠ Y502), G484 (= G503), M485 (≠ C504), V486 (≠ I505)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
25% identity, 73% coverage: 55:505/617 of query aligns to 51:486/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (= H427), G426 (≠ S445), M428 (= M447), G452 (= G471), D453 (= D472), G454 (= G473), S455 (= S474), M458 (= M477), N480 (= N499), H482 (≠ G501), L483 (≠ Y502), G484 (= G503), M485 (≠ C504), V486 (≠ I505)
- binding flavin-adenine dinucleotide: R161 (≠ D180), G222 (= G239), G223 (= G240), G224 (= G241), T246 (= T265), L247 (≠ Q266), M248 (≠ A267), L264 (≠ V283), M266 (≠ V285), H267 (≠ T286), G286 (= G305), V287 (≠ S306), R288 (= R307), D290 (≠ Q309), R292 (≠ F311), V293 (≠ T312), D310 (≠ N330), I311 (≠ V331), D329 (vs. gap), V330 (≠ I345), M405 (≠ L429), G423 (≠ Y442)
- binding magnesium ion: F370 (≠ A383), D453 (= D472), M458 (= M477), Q461 (≠ S480), N480 (= N499), H482 (≠ G501)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ V285), R292 (≠ F311), M485 (≠ C504)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
25% identity, 73% coverage: 55:505/617 of query aligns to 51:486/582 of 5wj1A
- active site: E59 (= E67), T82 (≠ S92), F121 (= F148), Q122 (≠ K149), E123 (vs. gap), K171 (≠ Q190), M266 (≠ V285), V293 (≠ T312), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D472), N480 (= N499), H482 (≠ G501), L483 (≠ Y502), M485 (≠ C504), V486 (≠ I505)
- binding flavin-adenine dinucleotide: R161 (≠ D180), G222 (= G239), G223 (= G240), G224 (= G241), T246 (= T265), L247 (≠ Q266), M248 (≠ A267), M263 (≠ S282), L264 (≠ V283), G286 (= G305), R288 (= R307), V293 (≠ T312), D310 (≠ N330), I311 (≠ V331), D329 (vs. gap), V330 (≠ I345), M405 (≠ L429), G423 (≠ Y442), G424 (= G443)
- binding magnesium ion: D453 (= D472), N480 (= N499), H482 (≠ G501)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ V285), D291 (= D310), R292 (≠ F311), M485 (≠ C504)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (= H427), M428 (= M447), D453 (= D472), G454 (= G473), S455 (= S474), M458 (= M477), N480 (= N499), H482 (≠ G501), L483 (≠ Y502), G484 (= G503), M485 (≠ C504), V486 (≠ I505)
Sites not aligning to the query:
- active site: 33, 35, 36, 37, 38, 489, 558
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: 489, 568
Query Sequence
>SMc01166 FitnessBrowser__Smeli:SMc01166
MSQKTVRLTMAQAVARFLTRQMTIIDGERVPIFGGVFAIFGHGNVAGVGEALYGVRETLP
TYRAQNEQGMANAAIAFAKASFRRRFMACTTSIGPGALNMVTSAALAHVNRLPVLLLPGD
VFANRRPDPVLQQVESFGDGTISANDCFKPVSRYFDRITRPEQIIPALRRAMQVLTDPAD
CGPVTLSLCQDVQAEAYDYPESFFDEKVWVPRRIEPDLDELASAIEALRSAKKPIIIAGG
GVLYSEASAELAAFAEKHGIPVVETQAGKSALPHSHPLNMGSVGVTGTSASNALAEEADV
VLAVGSRLQDFTTGSWALFKNEALKIIGLNVQAFDAGKHEGQPLISDARAGLNRISGGLG
SYKADSAWTERAKAGKAEWLAAAERATATTNAALPSDAQVIGAVQRARGGRKTTLVCAAG
GLPGELHKLWQAEEPGGYHMEYGFSTMGYEVAGGLGVKLAKPDSDVIVMVGDGSYMMLNS
EIASSIMLGAKFTVVLLDNAGYGCINRLQMGTGGANFNNLLKDTHHVELPQIDFAAHAAA
MGAVTRKVGSIPELEAALAETADEVRTTVIVIDTDPLITTEAGGHWWDVAVPEVSDRDQV
KAAREGYEKALQAQRFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory