SitesBLAST
Comparing SMc01214 FitnessBrowser__Smeli:SMc01214 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
100% identity, 98% coverage: 1:340/347 of query aligns to 4:343/343 of 4ej6A
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H61 (= H58), E62 (= E59), C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102), R109 (= R106), P147 (= P144), C151 (= C148), K337 (= K334)
- binding zinc ion: C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102)
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
100% identity, 98% coverage: 1:339/347 of query aligns to 4:342/342 of 4ejmA
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H61 (= H58), E62 (= E59), C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102), R109 (= R106), P147 (= P144), C151 (= C148), K337 (= K334)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G167), G172 (= G169), V173 (= V170), I174 (= I171), T194 (= T191), R195 (= R192), Q196 (= Q193), K199 (= K196), C240 (= C237), E245 (= E242), T246 (= T243), L263 (= L260), V265 (= V262), I291 (= I288)
- binding zinc ion: C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
33% identity, 93% coverage: 16:339/347 of query aligns to 21:347/350 of Q5JI69
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
33% identity, 93% coverage: 16:339/347 of query aligns to 19:345/347 of 3gfbA
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H65 (= H58), E66 (= E59), C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102), K113 (≠ R106), P151 (= P144), A155 (≠ C148), K340 (= K334)
- binding nicotinamide-adenine-dinucleotide: G173 (= G167), G175 (= G169), P176 (≠ V170), L177 (≠ I171), S196 (= S190), E197 (≠ T191), P198 (≠ R192), R202 (≠ K196), F241 (≠ C237), S242 (≠ A238), A244 (≠ V240), L264 (= L260), G265 (= G261), L266 (≠ V262), I289 (≠ S286), T290 (≠ F287)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
32% identity, 87% coverage: 16:316/347 of query aligns to 21:323/348 of O58389
- C42 (= C37) binding
- T44 (= T39) mutation to A: Total loss of enzymatic activity.
- H67 (= H58) binding
- E68 (= E59) binding
- C97 (= C88) binding
- C100 (= C91) binding
- C103 (= C94) binding
- C111 (= C102) binding
- E152 (= E143) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I171) binding
- E199 (≠ T191) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ K196) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ LGV 260:262) binding
- IT 291:292 (≠ SF 286:287) binding
- R294 (≠ N289) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
32% identity, 87% coverage: 16:316/347 of query aligns to 19:321/346 of 2dfvA
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H65 (= H58), E66 (= E59), C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102), K113 (≠ R106), P151 (= P144), A155 (≠ C148)
- binding nicotinamide-adenine-dinucleotide: G175 (= G169), P176 (≠ V170), L177 (≠ I171), E197 (≠ T191), P198 (≠ R192), R202 (≠ K196), F241 (≠ C237), S242 (≠ A238), A244 (≠ V240), L264 (= L260), G265 (= G261), L266 (≠ V262), I289 (≠ S286), T290 (≠ F287)
- binding zinc ion: C95 (= C88), C101 (= C94), C109 (= C102)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
30% identity, 92% coverage: 1:319/347 of query aligns to 1:320/341 of P07913
- C38 (= C37) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
30% identity, 89% coverage: 6:313/347 of query aligns to 8:317/347 of 5vm2A
- active site: C39 (= C37), G40 (= G38), S41 (≠ T39), H44 (= H42), H65 (= H58), E66 (= E59), C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102), D113 (≠ R106), P153 (= P144), G157 (≠ C148)
- binding magnesium ion: H65 (= H58), E66 (= E59), E152 (= E143)
- binding zinc ion: C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102)
Sites not aligning to the query:
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
32% identity, 98% coverage: 1:339/347 of query aligns to 1:346/346 of 4uejA
- active site: C38 (= C37), G39 (= G38), S40 (≠ T39), P43 (≠ H42), H59 (= H58), E60 (= E59), C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102), D107 (≠ R106), P145 (= P144), G149 (≠ C148), K341 (= K334)
- binding glycerol: H59 (= H58), E144 (= E143)
- binding zinc ion: C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102)
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
32% identity, 98% coverage: 1:339/347 of query aligns to 1:346/346 of 4a2cA
- active site: C38 (= C37), G39 (= G38), S40 (≠ T39), P43 (≠ H42), H59 (= H58), E60 (= E59), C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102), D107 (≠ R106), P145 (= P144), G149 (≠ C148), K341 (= K334)
- binding zinc ion: C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
30% identity, 94% coverage: 1:325/347 of query aligns to 4:321/337 of 4ilkA
- active site: C40 (= C37), G41 (= G38), S42 (≠ T39), H45 (= H42), H59 (= H58), E60 (= E59), C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102), A107 (≠ R106), P145 (= P144), A149 (≠ C148)
- binding manganese (ii) ion: C40 (= C37), H59 (= H58), E60 (= E59), E144 (= E143)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G167), G170 (= G169), P171 (≠ V170), I172 (= I171), D193 (≠ T191), R194 (= R192), R198 (≠ K196), N213 (≠ P211), A235 (≠ C237), A236 (= A238), C237 (≠ G239), I241 (≠ T243), M258 (≠ L260), F260 (≠ V262)
- binding zinc ion: C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102)
Sites not aligning to the query:
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
31% identity, 92% coverage: 1:319/347 of query aligns to 2:318/339 of 5kiaA
- active site: C37 (= C37), G38 (= G38), T39 (= T39), H42 (= H42), H61 (= H58), E62 (= E59), C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102), V109 (≠ R106), P147 (= P144), A151 (≠ C148)
- binding calcium ion: D146 (≠ E143), N150 (≠ C147), E288 (≠ P290)
- binding zinc ion: C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102)
Sites not aligning to the query:
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
30% identity, 93% coverage: 19:341/347 of query aligns to 20:343/343 of 2ejvA
- active site: C38 (= C37), G39 (= G38), T40 (= T39), H43 (= H42), H63 (= H58), E64 (= E59), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102), Q111 (≠ R106), P149 (= P144), A153 (≠ C148), K336 (= K334)
- binding nicotinamide-adenine-dinucleotide: G172 (= G167), G174 (= G169), P175 (≠ V170), I176 (= I171), S195 (= S190), D196 (≠ T191), P197 (≠ R192), R201 (≠ K196), F238 (≠ C237), S239 (≠ A238), N241 (≠ V240), A244 (≠ T243), L261 (= L260), G262 (= G261), I263 (≠ V262)
- binding zinc ion: C38 (= C37), H63 (= H58), E64 (= E59), C96 (= C91), C99 (= C94), C107 (= C102)
2dq4A Crystal structure of threonine 3-dehydrogenase
30% identity, 93% coverage: 19:341/347 of query aligns to 20:343/343 of 2dq4A
- active site: C38 (= C37), G39 (= G38), T40 (= T39), H43 (= H42), H63 (= H58), E64 (= E59), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102), Q111 (≠ R106), P149 (= P144), A153 (≠ C148), K336 (= K334)
- binding zinc ion: C38 (= C37), H63 (= H58), E64 (= E59), C93 (= C88), C96 (= C91), C107 (= C102)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
30% identity, 93% coverage: 19:341/347 of query aligns to 20:343/343 of Q5SKS4
- C38 (= C37) binding
- H63 (= H58) binding
- E64 (= E59) binding
- C93 (= C88) binding
- C96 (= C91) binding
- C99 (= C94) binding
- C107 (= C102) binding
- I176 (= I171) binding
- D196 (≠ T191) binding
- R201 (≠ K196) binding
- LGI 261:263 (≠ LGV 260:262) binding
- IAG 286:288 (vs. gap) binding
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
29% identity, 95% coverage: 10:337/347 of query aligns to 16:345/354 of P07846
- C43 (= C37) binding
- Y49 (≠ L43) binding
- H67 (= H58) binding
- E68 (= E59) binding
- E153 (= E143) binding
- R296 (≠ I288) binding
- Y297 (≠ N289) binding
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
29% identity, 95% coverage: 10:337/347 of query aligns to 12:342/351 of 3qe3A
- active site: C39 (= C37), G40 (= G38), S41 (≠ T39), H44 (= H42), H64 (= H58), E65 (= E59), R94 (≠ C88), D97 (≠ C91), C100 (= C94), S108 (≠ C102), F112 (≠ R106), P151 (= P144), G155 (≠ C148), K339 (= K334)
- binding glycerol: Y45 (≠ L43), F54 (= F48), T116 (≠ I110), R293 (≠ I288)
- binding zinc ion: C39 (= C37), H64 (= H58), E65 (= E59)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
29% identity, 92% coverage: 19:337/347 of query aligns to 20:344/348 of 1e3jA
- active site: C38 (= C37), G39 (= G38), S40 (≠ T39), H43 (= H42), H63 (= H58), E64 (= E59), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102), T111 (≠ R106), P150 (= P144), G154 (≠ C148), K341 (= K334)
- binding phosphate ion: A174 (≠ G168), A196 (≠ T191), R197 (= R192), S198 (≠ Q193), R201 (≠ K196)
- binding zinc ion: C38 (= C37), H63 (= H58), E64 (= E59), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
33% identity, 90% coverage: 12:325/347 of query aligns to 13:321/336 of 6iqdA
- active site: C38 (= C37), T40 (= T39), H43 (= H42), H61 (= H58), C148 (= C147)
- binding zinc ion: C38 (= C37), H61 (= H58), E62 (= E59), C92 (= C88), C95 (= C91), C98 (= C94), C106 (= C102), C148 (= C147)
6ie0B X-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis
33% identity, 98% coverage: 1:340/347 of query aligns to 2:347/347 of 6ie0B
Query Sequence
>SMc01214 FitnessBrowser__Smeli:SMc01214
MKAVRLESVGNISVRNVGIPEPGPDDLLVKVEACGICGTDRHLLHGEFPSTPPVTLGHEF
CGIVVEAGSAVRDIAPGARITGDPNISCGRCPQCQAGRVNLCRNLRAIGIHRDGGFAEYV
LVPRKQAFEIPLTLDPVHGAFCEPLACCLHGVDLSGIKAGSTVAILGGGVIGLLTVQLAR
LAGATTVILSTRQATKRRLAEEVGATATVDPSAGDVVEAIAGPVGLVPGGVDVVIECAGV
AETVKQSTRLAKAGGTVVILGVLPQGEKVEIEPFDILFRELRVLGSFINPFVHRRAADLV
ATGAIEIDRMISRRISLDEAPDVISNPAAAGEVKVLVIPSAERVAQQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory