SitesBLAST
Comparing SMc01224 FitnessBrowser__Smeli:SMc01224 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
73% identity, 98% coverage: 1:316/324 of query aligns to 2:314/315 of 4jnqA
- active site: C137 (= C136), C140 (= C139), D141 (= D140)
- binding dihydroflavine-adenine dinucleotide: I12 (= I11), G13 (= G12), S14 (= S13), G15 (= G14), P16 (= P15), A17 (= A16), A36 (= A35), G37 (= G36), Q39 (≠ E38), G42 (= G41), Q43 (= Q42), L44 (= L43), N52 (= N51), I85 (≠ V84), A113 (= A112), T114 (= T113), C140 (= C139), G283 (= G285), D284 (= D286), R291 (= R293), Q292 (= Q294), A293 (= A295)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
54% identity, 96% coverage: 4:313/324 of query aligns to 7:315/319 of 5vt3B
- active site: C138 (= C136), C141 (= C139), D142 (= D140)
- binding flavin-adenine dinucleotide: G15 (= G12), S16 (= S13), G17 (= G14), P18 (= P15), A19 (= A16), T38 (≠ A35), G39 (= G36), Q41 (≠ E38), G44 (= G41), Q45 (= Q42), L46 (= L43), T49 (= T46), N54 (= N51), H86 (≠ L83), I87 (≠ V84), S114 (≠ A112), T115 (= T113), G116 (= G114), E162 (= E160), H247 (= H248), G287 (= G285), D288 (= D286), R295 (= R293), Q296 (= Q294), A297 (= A295), S300 (≠ A298)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L120), G156 (= G154), G157 (= G155), N158 (= N156), T159 (≠ S157), H178 (= H176), R179 (= R177), R180 (= R178), R184 (= R182), I245 (= I246), G246 (= G247), R295 (= R293), Q296 (= Q294)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
55% identity, 96% coverage: 4:313/324 of query aligns to 8:316/319 of 5u63B
- active site: C139 (= C136), C142 (= C139), D143 (= D140)
- binding flavin-adenine dinucleotide: G16 (= G12), S17 (= S13), G18 (= G14), P19 (= P15), A20 (= A16), T39 (≠ A35), G40 (= G36), Q42 (≠ E38), G45 (= G41), Q46 (= Q42), L47 (= L43), T50 (= T46), N55 (= N51), H87 (≠ L83), I88 (≠ V84), A115 (= A112), T116 (= T113), G117 (= G114), H248 (= H248), G288 (= G285), D289 (= D286), R296 (= R293), Q297 (= Q294), A298 (= A295), S301 (≠ A298)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ K118), G157 (= G154), H179 (= H176), R180 (= R177), R181 (= R178), I246 (= I246), G247 (= G247), H248 (= H248), R296 (= R293)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
54% identity, 97% coverage: 2:315/324 of query aligns to 3:316/321 of P0A9P4
- 36:43 (vs. 35:42, 75% identical) binding
- C136 (= C136) modified: Disulfide link with 139, Redox-active
- C139 (= C139) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 286:295, 80% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
53% identity, 97% coverage: 2:315/324 of query aligns to 2:315/316 of 1tdfA
- active site: C135 (= C136), S138 (≠ C139), D139 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G12), S13 (= S13), G14 (= G14), P15 (= P15), A16 (= A16), T35 (≠ A35), G36 (= G36), E38 (= E38), G41 (= G41), Q42 (= Q42), L43 (= L43), T46 (= T46), V49 (= V49), N51 (= N51), H83 (≠ L83), I84 (≠ V84), A111 (= A112), T112 (= T113), S138 (≠ C139), G285 (= G285), D286 (= D286), R293 (= R293), Q294 (= Q294), A295 (= A295), S298 (≠ A298)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L120), I151 (≠ V152), T156 (≠ S157), E159 (= E160), H175 (= H176), R176 (= R177), R181 (= R182), E183 (= E184), I243 (= I246), G244 (= G247), H290 (≠ D290), R293 (= R293)
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
53% identity, 97% coverage: 2:315/324 of query aligns to 2:315/320 of 1f6mA
- active site: S135 (≠ C136), C138 (= C139), D139 (= D140)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L120), G153 (= G154), G154 (= G155), N155 (= N156), T156 (≠ S157), E159 (= E160), H175 (= H176), R176 (= R177), R177 (= R178), R181 (= R182), I243 (= I246), G244 (= G247), H245 (= H248), R293 (= R293), Q294 (= Q294)
- binding flavin-adenine dinucleotide: G12 (= G12), S13 (= S13), G14 (= G14), P15 (= P15), A16 (= A16), T35 (≠ A35), G36 (= G36), E38 (= E38), G41 (= G41), Q42 (= Q42), L43 (= L43), T46 (= T46), V49 (= V49), N51 (= N51), H83 (≠ L83), I84 (≠ V84), A111 (= A112), T112 (= T113), G113 (= G114), H245 (= H248), G285 (= G285), D286 (= D286), R293 (= R293), Q294 (= Q294), A295 (= A295), S298 (≠ A298)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
48% identity, 95% coverage: 8:314/324 of query aligns to 5:303/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (≠ E38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ L83), V81 (= V84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G285), D275 (= D286), R282 (= R293), Q283 (= Q294), A284 (= A295), A287 (= A298)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ K118), H115 (≠ W119), L116 (= L120), R173 (= R177), E200 (= E204), I201 (≠ V205), I235 (= I246)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
48% identity, 95% coverage: 8:314/324 of query aligns to 5:303/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (≠ E38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ L83), V81 (= V84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G285), D275 (= D286), R282 (= R293), Q283 (= Q294), A284 (= A295), A287 (= A298)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L120), R173 (= R177), E200 (= E204), I201 (≠ V205)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
48% identity, 95% coverage: 8:314/324 of query aligns to 5:303/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (≠ E38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ L83), V81 (= V84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G285), D275 (= D286), R282 (= R293), Q283 (= Q294), A284 (= A295), A287 (= A298)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ K118), H115 (≠ W119), L116 (= L120), V148 (= V152), R173 (= R177), E200 (= E204), I201 (≠ V205)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
48% identity, 95% coverage: 8:314/324 of query aligns to 5:303/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (≠ E38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ L83), V81 (= V84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G285), D275 (= D286), R282 (= R293), Q283 (= Q294), A284 (= A295), A287 (= A298)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G154), G151 (= G155), D152 (≠ N156), S153 (= S157), E156 (= E160), H172 (= H176), R173 (= R177), R174 (= R178), R178 (= R182), I235 (= I246)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
48% identity, 95% coverage: 8:314/324 of query aligns to 6:304/306 of 5uthA
- active site: C133 (= C136), C136 (= C139), D137 (= D140)
- binding flavin-adenine dinucleotide: I9 (= I11), G10 (= G12), S11 (= S13), G12 (= G14), P13 (= P15), A14 (= A16), F32 (≠ I34), E33 (≠ A35), G34 (= G36), Q36 (≠ E38), G39 (= G41), A40 (≠ Q42), L41 (= L43), N49 (= N51), D81 (≠ L83), V82 (= V84), M110 (≠ T113), G111 (= G114), C136 (= C139), G275 (= G285), D276 (= D286), R283 (= R293), Q284 (= Q294), A285 (= A295), A288 (= A298)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
48% identity, 96% coverage: 5:314/324 of query aligns to 2:320/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (= I11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), Y31 (≠ I34), E32 (≠ A35), G33 (= G36), A36 (vs. gap), T38 (vs. gap), A39 (≠ E38), G42 (= G41), Q43 (= Q42), L44 (= L43), T47 (= T46), I50 (≠ V49), N52 (= N51), T84 (≠ L83), I85 (≠ V84), T120 (= T113), G121 (= G114), C146 (= C139), G291 (= G285), D292 (= D286), R299 (= R293), Q300 (= Q294), A301 (= A295), S304 (≠ A298)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G154), G164 (= G155), S166 (= S157), R186 (= R177), R187 (= R178), R191 (= R182), V252 (≠ I246)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
45% identity, 95% coverage: 8:316/324 of query aligns to 17:318/335 of P9WHH1
- SGPA 22:25 (= SGPA 13:16) binding
- Y32 (= Y23) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 35:42, 38% identical) binding
- N60 (= N51) binding
- V93 (= V84) binding
- C145 (= C136) modified: Disulfide link with 148, Redox-active
- C148 (= C139) modified: Disulfide link with 145, Redox-active
- S166 (= S157) binding
- H185 (= H176) binding
- R191 (= R182) binding
- I248 (= I246) binding
- Y268 (= Y266) binding
- D288 (= D286) binding
- R295 (= R293) binding
- RQAV 295:298 (= RQAV 293:296) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
45% identity, 95% coverage: 8:316/324 of query aligns to 8:309/313 of 2a87A
- active site: F39 (≠ Q39), L43 (= L43), D48 (= D48), C136 (= C136), C139 (= C139), D140 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G12), S13 (= S13), G14 (= G14), P15 (= P15), A16 (= A16), F34 (≠ I34), E35 (≠ A35), G36 (= G36), G40 (= G40), G41 (= G41), A42 (≠ Q42), L43 (= L43), T46 (= T46), V49 (= V49), N51 (= N51), D83 (≠ L83), V84 (= V84), M113 (≠ T113), C139 (= C139), G278 (= G285), D279 (= D286), R286 (= R293), Q287 (= Q294), A288 (= A295), V289 (= V296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L120), G155 (= G155), D156 (≠ N156), S157 (= S157), H176 (= H176), R177 (= R177), R178 (= R178), R182 (= R182), I239 (= I246), Y259 (= Y266), R283 (≠ D290), R286 (= R293)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
48% identity, 96% coverage: 5:314/324 of query aligns to 17:331/356 of 5w4cA
- binding calcium ion: E99 (≠ D82), E116 (≠ D99), E118 (≠ G101)
- binding flavin-adenine dinucleotide: I23 (= I11), G24 (= G12), S25 (= S13), P27 (= P15), G28 (≠ A16), Y46 (≠ I34), G48 (= G36), A51 (vs. gap), F54 (vs. gap), G58 (= G41), Q59 (= Q42), L60 (= L43), T63 (= T46), N68 (= N51), V101 (= V84), T134 (= T113), G135 (= G114), G302 (= G285), D303 (= D286), R310 (= R293), Q311 (= Q294), A312 (= A295), S315 (≠ A298)
Sites not aligning to the query:
2whdB Barley NADPH-dependent thioredoxin reductase 2 (see paper)
49% identity, 95% coverage: 5:313/324 of query aligns to 6:316/319 of 2whdB
- active site: C141 (= C136), C144 (= C139), D145 (= D140)
- binding flavin-adenine dinucleotide: G13 (= G12), S14 (= S13), G15 (= G14), P16 (= P15), A17 (= A16), G37 (= G36), A40 (vs. gap), G47 (= G41), Q48 (= Q42), L49 (= L43), T52 (= T46), N57 (= N51), T89 (≠ L83), V90 (= V84), T118 (= T113), G119 (= G114), C144 (= C139), G288 (= G285), D289 (= D286), R296 (= R293), Q297 (= Q294), A298 (= A295)
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
45% identity, 95% coverage: 5:313/324 of query aligns to 3:315/319 of 3itjB
- active site: C142 (= C136), C145 (= C139), D146 (= D140)
- binding flavin-adenine dinucleotide: I9 (= I11), G10 (= G12), S11 (= S13), G12 (= G14), P13 (= P15), A14 (= A16), Y32 (≠ I34), E33 (≠ A35), G34 (= G36), A37 (vs. gap), I40 (vs. gap), A41 (≠ E38), G44 (= G41), Q45 (= Q42), T49 (= T46), I52 (≠ V49), N54 (= N51), T86 (≠ L83), V87 (= V84), T119 (= T113), G120 (= G114), W135 (≠ M129), C145 (= C139), G287 (= G285), D288 (= D286), R295 (= R293), Q296 (= Q294), A297 (= A295), S300 (≠ A298)
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
45% identity, 95% coverage: 5:313/324 of query aligns to 3:315/319 of P29509
- SGPA 11:14 (= SGPA 13:16) binding
- IA 40:41 (≠ -E 38) binding
- Q45 (= Q42) binding
- N54 (= N51) binding
- V87 (= V84) binding
- C142 (= C136) modified: Disulfide link with 145, Redox-active
- C145 (= C139) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D286) binding
- RQA 295:297 (= RQA 293:295) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
45% identity, 95% coverage: 5:313/324 of query aligns to 2:314/318 of 3d8xA
- active site: C141 (= C136), C144 (= C139), D145 (= D140)
- binding flavin-adenine dinucleotide: I8 (= I11), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), Y31 (≠ I34), G33 (= G36), A36 (vs. gap), I39 (vs. gap), G43 (= G41), Q44 (= Q42), I51 (≠ V49), N53 (= N51), T85 (≠ L83), V86 (= V84), T118 (= T113), G119 (= G114), C144 (= C139), G286 (= G285), D287 (= D286), R294 (= R293), Q295 (= Q294), A296 (= A295), S299 (≠ A298)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L120), G160 (= G153), S164 (= S157), R184 (= R177), K185 (≠ R178), R189 (= R182), I247 (= I246)
Q92375 Thioredoxin reductase; Caffeine resistance protein 4; EC 1.8.1.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
45% identity, 95% coverage: 5:313/324 of query aligns to 3:315/322 of Q92375
- S192 (≠ E184) modified: Phosphoserine
- T278 (= T276) modified: Phosphothreonine
- S279 (≠ D277) modified: Phosphoserine
Query Sequence
>SMc01224 FitnessBrowser__Smeli:SMc01224
MTARHTKVLIIGSGPAGYTAAIYTARAMLSPVLIAGMEQGGQLMITTDVENYPGYADPVQ
GPWMMEQMLNQAIHVGTEIVNDLVTDVDLSVRPFRIKTDSGTDWTADALIIATGAKAKWL
GIETEPTFMGFGVSACATCDGFFYRNKEVIVVGGGNSAVEEALYLSNLAKTVTVVHRRDA
FRAEKILQERLFAKPNVKVIWDHEVLEYLGTPAKPPMPASVNGVKLRNTKTGETSDMAID
GVFVAIGHAPAVELFKGKLRQKPNGYLWTAPDSTATDVAGVFAAGDVTDDIYRQAVTAAG
MGCMAALEAEKYLAGHMPAAIAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory