Comparing SMc01229 FitnessBrowser__Smeli:SMc01229 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
65% identity, 96% coverage: 2:163/169 of query aligns to 4:165/172 of A6VCX3
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
65% identity, 96% coverage: 2:163/169 of query aligns to 3:164/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
65% identity, 96% coverage: 2:163/169 of query aligns to 2:163/170 of 2j8rA
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
63% identity, 95% coverage: 3:163/169 of query aligns to 6:165/165 of 4jwpA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
58% identity, 100% coverage: 1:169/169 of query aligns to 3:171/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
58% identity, 100% coverage: 1:169/169 of query aligns to 1:169/171 of Q8ZPD3
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
43% identity, 90% coverage: 14:165/169 of query aligns to 22:173/180 of 2jlmF
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
41% identity, 96% coverage: 3:164/169 of query aligns to 5:165/165 of 4mbuA
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
42% identity, 98% coverage: 3:167/169 of query aligns to 5:169/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
41% identity, 97% coverage: 3:166/169 of query aligns to 6:170/181 of 5dwnA
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
35% identity, 95% coverage: 2:161/169 of query aligns to 3:160/175 of 5t7eD
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
35% identity, 95% coverage: 2:161/169 of query aligns to 2:159/173 of 5t7dA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
35% identity, 93% coverage: 1:158/169 of query aligns to 2:157/179 of 5wphA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
35% identity, 93% coverage: 1:158/169 of query aligns to 2:157/176 of 6m7gA
6wqcA Crystal structure of vipf from legionella hackeliae in complex with coa
26% identity, 82% coverage: 1:138/169 of query aligns to 150:272/293 of 6wqcA
Sites not aligning to the query:
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
25% identity, 93% coverage: 7:164/169 of query aligns to 10:165/165 of 2vi7C
>SMc01229 FitnessBrowser__Smeli:SMc01229
MEIRDAAETDLPAICAIYNDAVANTTAIWNETLVDVANRKTWLKARNAAGFPVLAALSLD
GEVVGYASFGEWRAFDGYRHTVEHSVYVRADQRGGGIGRALMLELIDRAEALGKHVMIAG
IESGNLPSIRLHEQLGFRETGHMKEVGTKFGRWLDLTFMQLILRTGSPD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory