Comparing SMc01498 FitnessBrowser__Smeli:SMc01498 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
26% identity, 97% coverage: 10:276/276 of query aligns to 12:280/281 of P94530
8hpsB ABC transporter, permease protein SugB (see paper)
29% identity, 77% coverage: 55:267/276 of query aligns to 48:263/264 of 8hpsB
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
32% identity, 74% coverage: 74:276/276 of query aligns to 87:295/296 of P68183
>SMc01498 FitnessBrowser__Smeli:SMc01498
MARNVSTGRKLITTVVAWTIGILIFFPILWTFLTSFKTEAQAIASPPVFLFFDWTTENYS
EVQSRSDYLKHFMNSVVVSFGSTLLGLLIAIPSAWAMAFSPTKRTKDVLMWMLSTKMMPP
VGVLVPMYLIFRNWGLLDTRTGLVIVLTLINLPIIIWMLYTYFKEIPGEILEAARMDGAS
LTKEIIYVLTPMAIPGIASTLLLNIILAWNEAFWTLNLSAAKAAPLTAFIASYSSPEGLF
YAKLSAASTMAIAPILILGWFSQKQLVRGLTFGAVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory