Comparing SMc01510 FitnessBrowser__Smeli:SMc01510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 95% coverage: 6:253/262 of query aligns to 16:260/265 of P07821
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
35% identity, 84% coverage: 1:221/262 of query aligns to 1:217/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
35% identity, 84% coverage: 1:219/262 of query aligns to 1:215/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
34% identity, 84% coverage: 1:221/262 of query aligns to 1:217/218 of 8hd0A
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
33% identity, 81% coverage: 27:239/262 of query aligns to 25:230/231 of 1l7vC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 88% coverage: 1:230/262 of query aligns to 2:225/241 of 4u00A
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
32% identity, 83% coverage: 27:243/262 of query aligns to 25:234/248 of 4fi3C
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
32% identity, 87% coverage: 13:241/262 of query aligns to 17:240/280 of 5x40A
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 87% coverage: 1:228/262 of query aligns to 4:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
32% identity, 87% coverage: 1:228/262 of query aligns to 4:228/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
32% identity, 87% coverage: 1:228/262 of query aligns to 2:226/253 of 6z5uK
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
32% identity, 76% coverage: 15:213/262 of query aligns to 21:215/226 of 5xu1B
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 90% coverage: 4:238/262 of query aligns to 5:233/233 of 6b8bA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 90% coverage: 4:238/262 of query aligns to 5:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 90% coverage: 4:238/262 of query aligns to 5:233/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 90% coverage: 4:238/262 of query aligns to 5:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 90% coverage: 4:238/262 of query aligns to 5:233/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 90% coverage: 4:238/262 of query aligns to 5:233/235 of 6mhzA
3nhaA Nucleotide binding domain of human abcb6 (adp mg bound structure) (see paper)
32% identity, 87% coverage: 2:230/262 of query aligns to 41:263/278 of 3nhaA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 91% coverage: 1:238/262 of query aligns to 2:233/240 of 6mjpA
>SMc01510 FitnessBrowser__Smeli:SMc01510
MIRASDISVRLAGRQVLHGISLDAAPGAMTAIVGPNGSGKTTTLKAISGELTPSAGKVTI
NGRDIASLKPWELALKRGVLPQSTVISFPFTVREIVRLGLMANGGEASAHGRIADQALEA
VDLAGFSGRFYQELSGGEQQRVQLARVLCQISAPVAAGEPRYLLLDEPVSSLDIRHQLTI
MRLARQFCADGGGVVAVMHDLNLTSMFADQIVMMKAGRIRARGAPKDVLTDETMEAVFGC
RMRVSVAPAHDIPFVLPQSATM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory