Comparing SMc01531 FitnessBrowser__Smeli:SMc01531 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
46% identity, 96% coverage: 5:297/305 of query aligns to 17:304/306 of 4ebuA
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
46% identity, 88% coverage: 5:273/305 of query aligns to 17:276/294 of 4eumA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 88% coverage: 4:270/305 of query aligns to 6:263/319 of Q8ZKR2
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
32% identity, 87% coverage: 4:267/305 of query aligns to 3:259/300 of 1v1bA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 87% coverage: 4:267/305 of query aligns to 3:259/301 of 1v1aA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 87% coverage: 4:267/305 of query aligns to 3:259/309 of Q53W83
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
29% identity, 73% coverage: 48:271/305 of query aligns to 46:265/322 of 3lkiB
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
29% identity, 68% coverage: 93:298/305 of query aligns to 102:297/312 of 3in1A
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
25% identity, 88% coverage: 4:272/305 of query aligns to 2:268/308 of 2dcnA
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
26% identity, 95% coverage: 5:295/305 of query aligns to 8:304/312 of 4wjmA
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
25% identity, 72% coverage: 54:272/305 of query aligns to 55:270/311 of 2varA
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 72% coverage: 54:272/305 of query aligns to 56:271/313 of Q97U29
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
25% identity, 86% coverage: 7:267/305 of query aligns to 5:254/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
25% identity, 86% coverage: 7:267/305 of query aligns to 4:253/302 of 3gbuA
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 88% coverage: 4:270/305 of query aligns to 2:252/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
27% identity, 88% coverage: 4:270/305 of query aligns to 2:252/299 of 1tz3A
6a8cA Ribokinase from leishmania donovani with adp (see paper)
25% identity, 99% coverage: 5:305/305 of query aligns to 16:325/327 of 6a8cA
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
25% identity, 99% coverage: 5:305/305 of query aligns to 16:325/327 of 6a8bA
6a8aA Ribokinase from leishmania donovani with atp (see paper)
25% identity, 99% coverage: 5:305/305 of query aligns to 16:325/327 of 6a8aA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
25% identity, 72% coverage: 50:270/305 of query aligns to 46:260/306 of 5eynA
Sites not aligning to the query:
>SMc01531 FitnessBrowser__Smeli:SMc01531
MTGKLLSIGECMVELMQAERDMLRKGYAGDTFNTAYYARLFLPADWTVDYFTAVGTDTVS
DELLAFIESTGVGTAHIRRIEGRTPGLYMIHLKDGERSFSYWRSTSAAKLLADDPDRLRA
AIEAANVVFFSGITLAILSPDAAETLLAELRRAKAGGRQVVFDPNIRPRLWDDAARMRAT
IEAGGRAATMVMPSFDDEATHFGDASVEATIERYRALGAENVAVKDGKNGVTLCFAGKER
VHVPASQVSAVVDTTSAGDSFNGSFLARLASGDSPADAAAFAARIAAAVIGHHGALIGRD
KLPRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory