SitesBLAST
Comparing SMc01532 FitnessBrowser__Smeli:SMc01532 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
59% identity, 97% coverage: 11:538/547 of query aligns to 4:526/535 of 3wy2A
- active site: D97 (= D104), R197 (= R204), D199 (= D206), E268 (= E276), H329 (= H338), D330 (= D339)
- binding beta-D-glucopyranose: D59 (= D66), Y62 (= Y69), H102 (= H109), R197 (= R204), D199 (= D206), E268 (= E276), H329 (= H338), D330 (= D339), R397 (= R407)
- binding glycerol: S101 (= S108), D169 (= D176), V170 (≠ L177), P175 (= P182), R178 (≠ Q185), Q179 (≠ E186), F203 (= F210), Y204 (= Y211), H206 (= H213), D240 (= D248), P244 (= P252), E280 (≠ A289)
- binding magnesium ion: D20 (= D27), R22 (≠ D29), V26 (≠ M33), D28 (= D35)
3wy1A Crystal structure of alpha-glucosidase (see paper)
59% identity, 97% coverage: 11:538/547 of query aligns to 4:526/535 of 3wy1A
- active site: D97 (= D104), R197 (= R204), D199 (= D206), E268 (= E276), H329 (= H338), D330 (= D339)
- binding glycerol: S101 (= S108), D169 (= D176), V170 (≠ L177), F203 (= F210), Y204 (= Y211), H206 (= H213)
- binding magnesium ion: D20 (= D27), D24 (= D31), V26 (≠ M33), D28 (= D35)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D66), Y62 (= Y69), H102 (= H109), F144 (= F151), F163 (= F170), R197 (= R204), D199 (= D206), T200 (= T207), G225 (≠ D233), E268 (= E276), F294 (= F303), H329 (= H338), D330 (= D339), R397 (= R407)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
59% identity, 97% coverage: 11:538/547 of query aligns to 4:526/535 of 3wy4A
- active site: D97 (= D104), R197 (= R204), D199 (= D206), Q268 (≠ E276), H329 (= H338), D330 (= D339)
- binding alpha-D-glucopyranose: D59 (= D66), Y62 (= Y69), H102 (= H109), I143 (= I150), F163 (= F170), D199 (= D206), T200 (= T207), G225 (≠ D233), Q268 (≠ E276), Q268 (≠ E276), F294 (= F303), H329 (= H338), D330 (= D339), R397 (= R407), R397 (= R407)
- binding glycerol: S101 (= S108), D169 (= D176), V170 (≠ L177), F203 (= F210), Y204 (= Y211), H206 (= H213), L224 (≠ R232), G225 (≠ D233), A226 (= A234), P227 (= P235), F294 (= F303), D330 (= D339), E374 (= E384), K395 (≠ A405), G396 (= G406), G399 (= G409)
- binding magnesium ion: D20 (= D27), D24 (= D31), V26 (≠ M33), D28 (= D35)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
57% identity, 67% coverage: 11:379/547 of query aligns to 4:323/421 of 3wy4B
- active site: D75 (= D104), R175 (= R204), D177 (= D206), Q237 (≠ E276)
- binding glycerol: S79 (= S108), N140 (= N169), D147 (= D176), F181 (= F210), Y182 (= Y211), F183 (= F212), H184 (= H213), D209 (= D248)
2ze0A Alpha-glucosidase gsj (see paper)
39% identity, 92% coverage: 9:509/547 of query aligns to 2:489/531 of 2ze0A
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
36% identity, 93% coverage: 11:518/547 of query aligns to 2:524/555 of 4m56A
- active site: D95 (= D104), R195 (= R204), D197 (= D206), E250 (= E276), H326 (= H338), D327 (= D339)
- binding D-glucose: D57 (= D66), Y60 (= Y69), H100 (= H109), F142 (= F151), D197 (= D206), E250 (= E276), D327 (= D339), R413 (= R407)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
36% identity, 93% coverage: 11:518/547 of query aligns to 2:524/556 of 5wczA
- active site: D95 (= D104), R195 (= R204), D197 (= D206), E250 (= E276), H326 (= H338), D327 (= D339)
- binding 1-deoxynojirimycin: D57 (= D66), Y60 (= Y69), H100 (= H109), F161 (= F170), D197 (= D206), V198 (= V224), E250 (= E276), H326 (= H338), D327 (= D339), R413 (= R407)
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
35% identity, 93% coverage: 11:518/547 of query aligns to 4:529/561 of O06994
- D20 (= D27) binding
- N22 (≠ D29) binding
- D24 (= D31) binding
- F26 (≠ M33) binding
- D28 (= D35) binding
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
35% identity, 93% coverage: 11:518/547 of query aligns to 2:527/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
35% identity, 93% coverage: 11:518/547 of query aligns to 2:527/559 of 7lv6B
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
35% identity, 92% coverage: 9:513/547 of query aligns to 1:511/546 of 8ibkA
- binding calcium ion: D19 (= D27), N21 (≠ D29), D23 (= D31), I25 (≠ M33), D27 (= D35)
- binding alpha-D-glucopyranose: D58 (= D66), Y61 (= Y69), H101 (= H109), I141 (= I150), F161 (= F170), D197 (= D206), A198 (≠ T207), H201 (= H213), M227 (≠ V237), Q254 (≠ E276), Q254 (≠ E276), F280 (= F303), H320 (= H338), D321 (= D339), R405 (= R407)
Sites not aligning to the query:
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
36% identity, 90% coverage: 11:503/547 of query aligns to 7:529/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D66), Y65 (= Y69), H105 (= H109), Y150 (≠ I150), F170 (= F170), D207 (= D206), T208 (= T207), E265 (≠ D279), F291 (= F303), H338 (= H338), D339 (= D339), R431 (= R407), T529 (= T503)
- binding calcium ion: D23 (= D27), N25 (≠ D29), D27 (= D31), I29 (≠ M33), D31 (= D35)
- binding alpha-D-glucopyranose: R224 (≠ L223), F291 (= F303), A295 (≠ G307), E300 (vs. gap), S349 (vs. gap), D350 (vs. gap), D350 (vs. gap), A351 (≠ L349), Q427 (vs. gap), K428 (vs. gap)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R23), I29 (≠ M33), M63 (= M67), H74 (≠ D78), W454 (= W431)
Sites not aligning to the query:
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
34% identity, 93% coverage: 11:518/547 of query aligns to 3:520/555 of 5brpA
- active site: D96 (= D104), Q196 (≠ R204), D198 (= D206), E249 (= E276), H323 (= H338), D324 (= D339)
- binding magnesium ion: D19 (= D27), T21 (≠ D29), N23 (≠ D31), V25 (≠ M33), D27 (= D35)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D66), N59 (≠ M67), Y61 (= Y69), H101 (= H109), Y162 (≠ F170), D198 (= D206), V199 (≠ T207), E249 (= E276)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
36% identity, 92% coverage: 11:512/547 of query aligns to 6:519/557 of 4h8vA
- active site: D99 (= D104), R198 (= R204), D200 (= D206), E254 (= E276), H326 (= H338), D327 (= D339)
- binding calcium ion: D22 (= D27), N24 (≠ D29), D26 (= D31), I28 (≠ M33), D30 (= D35)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D66), Y64 (= Y69), H104 (= H109), F164 (= F170), D200 (= D206), E254 (= E276), F256 (≠ G278), R284 (≠ G307), R291 (vs. gap), H326 (= H338), D327 (= D339), E386 (≠ R399), R414 (= R407)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
36% identity, 92% coverage: 11:512/547 of query aligns to 6:519/557 of 2pwdA
- active site: D99 (= D104), R198 (= R204), D200 (= D206), E254 (= E276), H326 (= H338), D327 (= D339)
- binding calcium ion: D22 (= D27), N24 (≠ D29), D26 (= D31), I28 (≠ M33), D30 (= D35)
- binding 1-deoxynojirimycin: D61 (= D66), Y64 (= Y69), H104 (= H109), F164 (= F170), D200 (= D206), E254 (= E276), H326 (= H338), D327 (= D339), R414 (= R407)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
36% identity, 92% coverage: 11:512/547 of query aligns to 5:518/556 of 2pwgA
- active site: D98 (= D104), R197 (= R204), D199 (= D206), E253 (= E276), H325 (= H338), D326 (= D339)
- binding calcium ion: D21 (= D27), N23 (≠ D29), D25 (= D31), I27 (≠ M33), D29 (= D35)
- binding castanospermine: D60 (= D66), Y63 (= Y69), H103 (= H109), F163 (= F170), D199 (= D206), E253 (= E276), D326 (= D339), R413 (= R407)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
36% identity, 92% coverage: 11:512/547 of query aligns to 5:518/556 of 2pweA
- active site: D98 (= D104), R197 (= R204), D199 (= D206), Q253 (≠ E276), H325 (= H338), D326 (= D339)
- binding calcium ion: D21 (= D27), N23 (≠ D29), D25 (= D31), I27 (≠ M33), D29 (= D35)
- binding beta-D-fructofuranose: F163 (= F170), Q253 (≠ E276), F255 (≠ G278), D326 (= D339), R413 (= R407)
- binding alpha-D-glucopyranose: D60 (= D66), Y63 (= Y69), H103 (= H109), F163 (= F170), D199 (= D206), Q253 (≠ E276), H325 (= H338), D326 (= D339), R413 (= R407)
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
35% identity, 92% coverage: 11:515/547 of query aligns to 6:523/559 of 4howA
2pwfA Crystal structure of the mutb d200a mutant in complex with glucose (see paper)
36% identity, 92% coverage: 11:512/547 of query aligns to 4:517/555 of 2pwfA
- active site: D97 (= D104), R196 (= R204), A198 (≠ D206), E252 (= E276), H324 (= H338), D325 (= D339)
- binding beta-D-glucopyranose: D59 (= D66), Y62 (= Y69), H102 (= H109), F162 (= F170), R196 (= R204), A198 (≠ D206), E252 (= E276), H324 (= H338), D325 (= D339), R412 (= R407)
- binding calcium ion: D20 (= D27), N22 (≠ D29), D24 (= D31), I26 (≠ M33), D28 (= D35)
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
35% identity, 92% coverage: 11:515/547 of query aligns to 6:523/559 of 4hphA
- active site: D99 (= D104), R198 (= R204), D200 (= D206), Q254 (≠ E276), H327 (= H338), D328 (= D339)
- binding calcium ion: D22 (= D27), N24 (≠ D29), D26 (= D31), I28 (≠ M33), D30 (= D35)
- binding beta-D-fructofuranose: F164 (= F170), Q254 (≠ E276), F256 (≠ G278), D328 (= D339), E387 (≠ R399), R415 (= R407)
- binding alpha-D-glucopyranose: D61 (= D66), Y64 (= Y69), H104 (= H109), F164 (= F170), D200 (= D206), Q254 (≠ E276), H327 (= H338), D328 (= D339), R415 (= R407)
Query Sequence
>SMc01532 FitnessBrowser__Smeli:SMc01532
MPAASGSDENWWRGAVIYQVYPRSFQDTDGDGMGDLRGVTRRLPHIASLGVDAIWLSPFF
TSPQADMGYDVSDYCDVDPMFGTLADFDEMLAEAHRLGLKVIIDQVISHTSDRHPWFVES
RSSRTNAKADWYVWADPKPDGTAPNNWLSIFGGPGWEWDGVRRQYYLHNFLSSQPDLNFH
NPEVQEAVLATVRFWLDRGVDGFRLDTANFYFHDRLLRDNPPLVPDPDATSRDAPEVNPY
GMQDHLYDKTQPENLDFLRRFRAVLDEYGGRATVGEVGDGSRSLQTVAAYTSGGDKLHMC
YTFDLLGPEFTARHFRRCVENFQSTVTDGWVCWAFSNHDVMRHVSRFALREADRERVAKL
AISLLASLRGTICLYQGEELGLPEAELAFEELRDPYGIRFWPAFAGRDGCRTPMVWEREL
SNAGFSAGTPWLPVRDGHRMLAVDAQEGVEGAVLEHYRQTLGFRRAQSALVDGDMVFLGT
NQDLLVFTREKDDERLLFVFNLTQEPQTFHLPATLVAEPHPMPGFAPVFADNAIKLAALD
VFCGRLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory