Comparing SMc01534 FitnessBrowser__Smeli:SMc01534 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
64% identity, 97% coverage: 10:438/442 of query aligns to 7:435/439 of Q9A3Q9
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
51% identity, 99% coverage: 1:439/442 of query aligns to 1:445/448 of Q9I700
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
52% identity, 97% coverage: 11:439/442 of query aligns to 9:438/441 of 4b98A
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
50% identity, 97% coverage: 11:439/442 of query aligns to 3:432/435 of 4uhmA
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
50% identity, 97% coverage: 12:439/442 of query aligns to 9:438/441 of 3a8uX
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
39% identity, 93% coverage: 30:438/442 of query aligns to 2:414/422 of 7qx3A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
37% identity, 96% coverage: 18:441/442 of query aligns to 17:445/450 of 6gwiB
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
37% identity, 95% coverage: 18:438/442 of query aligns to 16:435/443 of 7qx0B
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 96% coverage: 10:434/442 of query aligns to 5:439/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 96% coverage: 10:434/442 of query aligns to 7:441/449 of 5lh9D
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
37% identity, 99% coverage: 3:438/442 of query aligns to 4:447/448 of 6io1B
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
37% identity, 91% coverage: 35:438/442 of query aligns to 31:434/444 of 3i5tA
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
38% identity, 93% coverage: 26:434/442 of query aligns to 28:444/453 of 6s54A
Sites not aligning to the query:
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
37% identity, 93% coverage: 30:441/442 of query aligns to 1:379/384 of 5ti8B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 91% coverage: 30:430/442 of query aligns to 34:442/458 of 5kr3A
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
34% identity, 98% coverage: 8:438/442 of query aligns to 4:435/443 of 6fyqA
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 92% coverage: 30:436/442 of query aligns to 31:454/455 of 5kr5A
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
38% identity, 96% coverage: 14:438/442 of query aligns to 12:444/454 of 7ypmA
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
35% identity, 94% coverage: 18:431/442 of query aligns to 16:434/453 of 6s4gA
7q9xAAA Probable aminotransferase
35% identity, 94% coverage: 18:431/442 of query aligns to 17:435/455 of 7q9xAAA
>SMc01534 FitnessBrowser__Smeli:SMc01534
MSNRLNTTPNDLSAFWMPFTANRQFKKEPRLFVGAKDMYYTTHDGRTVLDGTAGLWCVNA
GHCRPKITEAIREQAGELDYAPAFQLGHPKAFELANRLVDIAPEGMNHVLYTNSGSESVD
TALKVALAYHRAKGNGSRFRLIGRERGYHGVNFGGISVGGIVANRKMFGTLLTGVDHLPH
THLPAKNAFSRGEPEHGADLAAELERIVTLHDASTVAAVIVEPVAGSTGVLIPPKGYLQK
LREICTKHGILLIFDEVITGYGRLGTPFAAQYFDVKPDIITTAKGLTNGVIPMGAVFVTS
EIHDAFMTGPEHLIEFFHGYTYSGNPIASAAALGTLDTYREEGLLTRAAELAPYWEEALH
SLKDCPHVIDIRNIGLIGAVELEPIAGEPTKRAFSAFLKAYEKGLLIRTTGDIIALSPPL
IIEKRQIDELFDKLRDVLKNNI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory