Comparing SMc01583 FitnessBrowser__Smeli:SMc01583 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
44% identity, 85% coverage: 54:390/396 of query aligns to 3:343/346 of 7cdyA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
43% identity, 86% coverage: 51:391/396 of query aligns to 24:368/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
43% identity, 86% coverage: 51:391/396 of query aligns to 2:346/348 of 2g8sA
7cgzA Glucose dehydrogenase
41% identity, 85% coverage: 54:390/396 of query aligns to 3:318/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
36% identity, 84% coverage: 54:385/396 of query aligns to 4:318/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
36% identity, 84% coverage: 54:385/396 of query aligns to 6:319/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
36% identity, 84% coverage: 54:385/396 of query aligns to 6:319/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
30% identity, 86% coverage: 46:385/396 of query aligns to 3:317/334 of 3dasA
Sites not aligning to the query:
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
27% identity, 85% coverage: 55:389/396 of query aligns to 20:425/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
27% identity, 85% coverage: 55:389/396 of query aligns to 20:425/444 of 1c9uA
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
26% identity, 85% coverage: 55:389/396 of query aligns to 20:431/453 of 5minB
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
27% identity, 85% coverage: 55:389/396 of query aligns to 20:429/448 of 1cruA
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
26% identity, 85% coverage: 55:389/396 of query aligns to 44:455/478 of P13650
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
22% identity, 53% coverage: 51:260/396 of query aligns to 3:232/438 of 7pgnB
Sites not aligning to the query:
>SMc01583 FitnessBrowser__Smeli:SMc01583
MRHTRWNAGGSRDIATVFPFPMAAAVSLFLAFASSPAAAQETREFPTQTGTVLVETLASG
LEHPWAVEAMPDGALIVTERPGRLRILRDGKLSAAIKGVPTAAAHGQGGLLDVALDRQFA
TNRTLYLTLSVRGDGGYGTVLVRAALSQDEQSLTEVKEIFRMNKFTRKGQHFGSRIAIDK
DGSLFFGIGDRGEGERAQDSRDHAGSILHINADGSIPASNPYRGGTGGLAEIWSIGHRNP
QGITFDPEGGKLLTVEHGARGGDEVNNPQPGKNYGWPVITFGKDYSGVEIGEGTAKEGLE
QPLFYWDPSIAPGAIAVYRGSMFPEWNGDLLIAALKYQLLARLDRDETGAVTNEERLFDG
EFGRIRDVIVASDGALIMVTDEEDGAVLRVSKAPTQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory