SitesBLAST
Comparing SMc01698 FitnessBrowser__Smeli:SMc01698 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
51% identity, 98% coverage: 5:250/251 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G18), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (= S17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ R39), A61 (≠ V63), D62 (= D64), T63 (≠ V65), N89 (= N91), A90 (= A92), M140 (= M142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), Y187 (≠ W189), I188 (= I190), L192 (= L194)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
55% identity, 98% coverage: 5:250/251 of query aligns to 11:256/257 of 5h5xC
- active site: G24 (= G18), S151 (= S144), Y164 (= Y157), K168 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), S23 (= S17), G24 (= G18), I25 (= I19), D44 (= D38), F45 (≠ R39), L69 (≠ V63), D70 (= D64), N97 (= N91), A98 (= A92), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (= G188), I197 (= I190), T199 (= T192)
7v1qA Leifsonia alcohol dehydrogenases lnadh (see paper)
51% identity, 96% coverage: 10:251/251 of query aligns to 11:251/251 of 7v1qA
- binding nicotinamide-adenine-dinucleotide: G15 (= G14), S18 (= S17), G19 (= G18), I20 (= I19), D39 (= D38), L40 (≠ R39), D65 (= D64), V66 (= V65), N91 (= N91), M142 (= M142), Y157 (= Y157), K161 (= K161), P187 (= P187), G188 (= G188), F189 (≠ W189), I190 (= I190)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
47% identity, 98% coverage: 5:250/251 of query aligns to 3:247/248 of 4urfB
- active site: G16 (= G18), S142 (= S144), I152 (≠ A154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L213), R211 (≠ G214), R212 (= R215)
- binding bicarbonate ion: I92 (= I94), G94 (= G96), R109 (= R111), R179 (= R181), S228 (= S231)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (= G16), N15 (≠ S17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ R39), D62 (= D64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ M142), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), I188 (= I190), T190 (= T192)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
47% identity, 98% coverage: 5:250/251 of query aligns to 3:247/248 of 4urfA
- active site: G16 (= G18), S142 (= S144), I152 (≠ A154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I94), S93 (≠ E95), G94 (= G96), E95 (≠ P97), T97 (≠ Q99), E101 (≠ D103), T103 (≠ P105), Q106 (≠ D108), R109 (= R111), S175 (≠ R177), G177 (= G179)
- binding magnesium ion: S237 (= S240), Y238 (= Y241)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (= G16), N15 (≠ S17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ R39), W41 (≠ A43), D62 (= D64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ M142), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
47% identity, 98% coverage: 5:250/251 of query aligns to 3:247/248 of 4ureB
- active site: G16 (= G18), S142 (= S144), I152 (≠ A154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S17), G16 (= G18), I17 (= I19), N89 (= N91), G91 (= G93), Y155 (= Y157), P185 (= P187), A186 (≠ G188)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
44% identity, 98% coverage: 5:250/251 of query aligns to 3:250/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (= I19), D36 (= D38), L37 (≠ R39), C61 (≠ V63), D62 (= D64), V63 (= V65), N89 (= N91), A90 (= A92), T140 (≠ M142), S142 (= S144), Y155 (= Y157), K159 (= K161), A186 (≠ G188), V187 (≠ W189)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
35% identity, 98% coverage: 5:251/251 of query aligns to 4:260/260 of 6zzqA
- active site: G17 (= G18), S142 (= S144), Y155 (= Y157)
- binding acetoacetic acid: Q94 (≠ E95), S142 (= S144), K152 (≠ A154), Y155 (= Y157), Q196 (≠ H198)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), S16 (= S17), G17 (= G18), I18 (= I19), D37 (= D38), M38 (≠ R39), D63 (= D64), V64 (= V65), N90 (= N91), A91 (= A92), G92 (= G93), M140 (= M142), A141 (≠ S143), S142 (= S144), Y155 (= Y157), K159 (= K161), Y187 (≠ W189), V188 (≠ I190), T190 (= T192)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 98% coverage: 5:251/251 of query aligns to 5:261/261 of 6zzsD
- active site: G18 (= G18), S143 (= S144), Y156 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (= S17), I19 (= I19), D38 (= D38), M39 (≠ R39), D64 (= D64), V65 (= V65), N91 (= N91), A92 (= A92), G93 (= G93), M141 (= M142), A142 (≠ S143), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (= G188), V189 (≠ I190), T191 (= T192), L193 (= L194)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ E95), S143 (= S144), N145 (≠ L146), K153 (≠ A154), Y156 (= Y157), Q197 (≠ H198)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 100% coverage: 1:251/251 of query aligns to 1:255/255 of 5itvA
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (= S17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ A41), T61 (≠ V63), I63 (≠ V65), N89 (= N91), G91 (= G93), T139 (≠ M142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I186 (≠ W189), I187 (= I190)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
38% identity, 98% coverage: 5:250/251 of query aligns to 8:252/258 of 4wecA
- active site: G21 (= G18), S143 (= S144), Q154 (≠ S155), Y157 (= Y157), K161 (= K161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (≠ G16), S20 (= S17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (≠ R39), V61 (= V63), D62 (= D64), V63 (= V65), N89 (= N91), T141 (≠ M142), Y157 (= Y157), K161 (= K161), P187 (= P187), P189 (≠ W189), V190 (≠ I190)
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 98% coverage: 5:250/251 of query aligns to 3:243/251 of 6vspA
- active site: G16 (= G18), S138 (= S144), Y151 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), N15 (≠ S17), G16 (= G18), M17 (≠ I19), D36 (= D38), W37 (≠ R39), W37 (≠ R39), A38 (≠ D40), I59 (≠ V63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), V90 (≠ I94), V110 (= V115), T136 (≠ M142), S138 (= S144), Y151 (= Y157), K155 (= K161), P181 (= P187), S182 (≠ G188), L183 (≠ W189), V184 (≠ I190), T186 (= T192), N187 (≠ P193), M188 (≠ L194), T189 (≠ L195)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 98% coverage: 5:250/251 of query aligns to 5:245/252 of 6vspB
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
38% identity, 98% coverage: 5:250/251 of query aligns to 3:243/251 of 6xewA
- active site: G16 (= G18), S138 (= S144), Y151 (= Y157)
- binding r,3-hydroxybutan-2-one: S138 (= S144), S140 (≠ L146), Y151 (= Y157)
- binding s,3-hydroxybutan-2-one: S138 (= S144), Y151 (= Y157), S182 (≠ G188)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), N15 (≠ S17), G16 (= G18), M17 (≠ I19), D36 (= D38), W37 (≠ R39), W37 (≠ R39), A38 (≠ D40), I59 (≠ V63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), V110 (= V115), T136 (≠ M142), S138 (= S144), Y151 (= Y157), K155 (= K161), S182 (≠ G188), L183 (≠ W189), V184 (≠ I190), T186 (= T192), N187 (≠ P193), M188 (≠ L194), T189 (≠ L195)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
38% identity, 98% coverage: 5:250/251 of query aligns to 3:243/251 of H9XP47
- N15 (≠ S17) binding
- M17 (≠ I19) binding
- D36 (= D38) binding
- D60 (= D64) binding
- V61 (= V65) binding
- N87 (= N91) binding
- S138 (= S144) binding ; binding
- V139 (≠ I145) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ L146) binding
- Y151 (= Y157) binding ; binding ; binding
- K155 (= K161) binding
- V184 (≠ I190) binding
- T186 (= T192) binding
- RDK 197:199 (≠ KTR 203:205) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
40% identity, 93% coverage: 6:238/251 of query aligns to 5:248/261 of P16544
- 11:39 (vs. 12:40, 55% identical) binding
- D63 (= D64) binding
- K161 (= K161) binding
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
40% identity, 93% coverage: 6:238/251 of query aligns to 3:246/259 of 1w4zA
- active site: G15 (= G18), N112 (= N116), S142 (= S144), Y155 (= Y157), K159 (= K161), Y200 (≠ H198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), T13 (≠ G16), S14 (= S17), G15 (= G18), I16 (= I19), R36 (= R39), G37 (≠ D40), D61 (= D64), V62 (= V65), N88 (= N91), G90 (= G93), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), V188 (≠ I190), T190 (= T192)
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
40% identity, 93% coverage: 6:238/251 of query aligns to 12:255/268 of 2rh4B
- active site: G24 (= G18), N121 (= N116), S151 (= S144), Y164 (= Y157), K168 (= K161), Y209 (≠ H198)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G14), T22 (≠ G16), S23 (= S17), I25 (= I19), A44 (≠ D38), R45 (= R39), G46 (≠ D40), C69 (≠ V63), D70 (= D64), V71 (= V65), N97 (= N91), S151 (= S144), Y164 (= Y157), K168 (= K161), G195 (= G188), V197 (≠ I190), T199 (= T192), M201 (≠ L194)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
40% identity, 93% coverage: 6:238/251 of query aligns to 1:244/257 of 2rh4A
- active site: G13 (= G18), N110 (= N116), S140 (= S144), Y153 (= Y157), K157 (= K161), Y198 (≠ H198)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ I145), Q145 (≠ V149), V147 (≠ L151), Y153 (= Y157), F185 (≠ W189)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G14), T11 (≠ G16), S12 (= S17), G13 (= G18), I14 (= I19), A33 (≠ D38), R34 (= R39), G35 (≠ D40), C58 (≠ V63), D59 (= D64), V60 (= V65), N86 (= N91), G88 (= G93), S140 (= S144), Y153 (= Y157), K157 (= K161), P183 (= P187), G184 (= G188), V186 (≠ I190), T188 (= T192), M190 (≠ L194)
Sites not aligning to the query:
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
41% identity, 92% coverage: 8:238/251 of query aligns to 2:243/256 of 1xr3A
- active site: G12 (= G18), N109 (= N116), S139 (= S144), Y152 (= Y157), K156 (= K161), Y197 (≠ H198)
- binding 4-(diazenylcarbonyl)pyridine: T140 (≠ I145), G141 (≠ L146), V146 (≠ L151)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), T10 (≠ G16), S11 (= S17), G12 (= G18), I13 (= I19), A32 (≠ D38), R33 (= R39), G34 (≠ D40), C57 (≠ V63), D58 (= D64), V59 (= V65), N85 (= N91), A86 (= A92), G87 (= G93), S139 (= S144), Y152 (= Y157), K156 (= K161), G183 (= G188), V185 (≠ I190), T187 (= T192), P188 (= P193)
Query Sequence
>SMc01698 FitnessBrowser__Smeli:SMc01698
MKLGLEGKIAIVTGAGSGIGAAVSRQLGGEGAEVIVADRDADAARSVAAEIRSAGGRARD
FTVDVTDAGAVEQMVAFTVRECGGLHLAVNNAGIEGPRQATADYPLEDWRRLIEVNLNGV
FYCMKYEIAAMLGKGGGAIVNMSSILGAVALPTASAYTAAKHGVVGLTKAAGIEYARMGI
RINAVGPGWIETPLLSGHSELAKTRRLEALQPLGRRGKPEEVAALVCFLLSEQASFITGS
YHPVDGAFTAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory