SitesBLAST
Comparing SMc01712 FitnessBrowser__Smeli:SMc01712 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
37% identity, 93% coverage: 27:400/403 of query aligns to 2:354/369 of P05414
- Y24 (= Y49) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (= PTA 102:104) binding
- S106 (= S131) binding
- W108 (≠ L133) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (≠ QFY 152:154) binding
- T155 (= T180) binding
- K230 (= K276) binding
- S252 (= S298) binding
- DGGVR 285:289 (≠ DGGVQ 331:335) binding
- GR 308:309 (= GR 354:355) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
36% identity, 93% coverage: 27:400/403 of query aligns to 2:345/350 of 1al7A
- active site: S106 (= S131), Y129 (= Y154), T155 (= T180), D157 (= D182), K221 (= K276), H245 (= H300)
- binding flavin mononucleotide: Y24 (= Y49), Y25 (≠ I50), P77 (= P102), T78 (= T103), A79 (= A104), S106 (= S131), Q127 (= Q152), T155 (= T180), K221 (= K276), H245 (= H300), R248 (= R303), D276 (= D331), G277 (= G332), R280 (≠ Q335), G299 (= G354), R300 (= R355)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y49), W108 (≠ L133), Y129 (= Y154), R164 (= R189), F172 (= F197), I198 (≠ L253), H245 (= H300), R248 (= R303)
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
36% identity, 93% coverage: 27:400/403 of query aligns to 1:348/353 of 5zbmB
- active site: Y128 (= Y154), D156 (= D182), H248 (= H300)
- binding flavin mononucleotide: Y23 (= Y49), Y24 (≠ I50), P76 (= P102), T77 (= T103), W107 (≠ L133), Q126 (= Q152), Y128 (= Y154), T154 (= T180), K224 (= K276), H248 (= H300), G249 (= G301), R251 (= R303), D279 (= D331), G280 (= G332), R283 (≠ Q335), G302 (= G354), R303 (= R355)
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
39% identity, 93% coverage: 30:402/403 of query aligns to 9:365/365 of Q8Z0C8
- M82 (≠ T103) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (= L133) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (= F249) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
37% identity, 93% coverage: 28:401/403 of query aligns to 7:359/360 of 6gmcA
- active site: Y132 (= Y154), D160 (= D182), H258 (= H300)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y49), M82 (≠ L105), W110 (≠ L133), Y132 (= Y154), R167 (= R189), F191 (≠ I213), L203 (≠ I245), Y206 (= Y248), H258 (= H300), R261 (= R303)
- binding flavin mononucleotide: Y26 (= Y49), Y27 (≠ I50), A79 (≠ P102), T80 (= T103), A81 (= A104), S108 (= S131), Q130 (= Q152), Y132 (= Y154), T158 (= T180), K234 (= K276), H258 (= H300), G259 (= G301), R261 (= R303), D289 (= D331), G290 (= G332), R293 (≠ Q335), G312 (= G354), R313 (= R355)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
37% identity, 93% coverage: 28:401/403 of query aligns to 4:352/353 of 5qieA
- active site: Y129 (= Y154), D157 (= D182), H251 (= H300)
- binding flavin mononucleotide: Y23 (= Y49), Y24 (≠ I50), A76 (≠ P102), T77 (= T103), A78 (= A104), S105 (= S131), Q127 (= Q152), Y129 (= Y154), K227 (= K276), H251 (= H300), G252 (= G301), R254 (= R303), D282 (= D331), G283 (= G332), R286 (≠ Q335), G305 (= G354), R306 (= R355)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: D322 (≠ R371)
Sites not aligning to the query:
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
37% identity, 93% coverage: 28:401/403 of query aligns to 7:361/362 of 6gmbA
- active site: Y132 (= Y154), D160 (= D182), H260 (= H300)
- binding flavin mononucleotide: Y26 (= Y49), Y27 (≠ I50), A79 (≠ P102), T80 (= T103), A81 (= A104), S108 (= S131), Q130 (= Q152), Y132 (= Y154), K236 (= K276), H260 (= H300), G261 (= G301), R263 (= R303), D291 (= D331), G292 (= G332), G293 (= G333), R295 (≠ Q335), G314 (= G354), R315 (= R355)
- binding glycolic acid: Y26 (= Y49), W110 (≠ L133), Y132 (= Y154), R167 (= R189), H260 (= H300), R263 (= R303)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
37% identity, 93% coverage: 28:401/403 of query aligns to 7:361/370 of Q9UJM8
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
37% identity, 93% coverage: 28:401/403 of query aligns to 4:358/359 of 5qigA
- active site: Y129 (= Y154), D157 (= D182), H257 (= H300)
- binding flavin mononucleotide: Y23 (= Y49), Y24 (≠ I50), A76 (≠ P102), T77 (= T103), A78 (= A104), S105 (= S131), Q127 (= Q152), Y129 (= Y154), T155 (= T180), K233 (= K276), H257 (= H300), G258 (= G301), R260 (= R303), D288 (= D331), G289 (= G332), G290 (= G333), R292 (≠ Q335), G311 (= G354), R312 (= R355)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: R223 (≠ V266), G248 (= G291), F320 (≠ A363), K324 (≠ A367), D328 (≠ R371)
Sites not aligning to the query:
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
37% identity, 93% coverage: 28:401/403 of query aligns to 4:358/359 of 5qifA
- active site: Y129 (= Y154), D157 (= D182), H257 (= H300)
- binding flavin mononucleotide: Y23 (= Y49), Y24 (≠ I50), A76 (≠ P102), T77 (= T103), A78 (= A104), S105 (= S131), Q127 (= Q152), Y129 (= Y154), K233 (= K276), H257 (= H300), G258 (= G301), R260 (= R303), D288 (= D331), G289 (= G332), R292 (≠ Q335), G311 (= G354), R312 (= R355)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (≠ V266), R224 (≠ Q267), S227 (≠ G270)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
37% identity, 93% coverage: 28:401/403 of query aligns to 4:358/359 of 2rdwA
- active site: S105 (= S131), Y129 (= Y154), T155 (= T180), D157 (= D182), K233 (= K276), H257 (= H300)
- binding flavin mononucleotide: Y23 (= Y49), Y24 (≠ I50), A76 (≠ P102), T77 (= T103), A78 (= A104), Q127 (= Q152), Y129 (= Y154), T155 (= T180), K233 (= K276), H257 (= H300), G258 (= G301), R260 (= R303), D288 (= D331), G289 (= G332), R292 (≠ Q335), G311 (= G354), R312 (= R355)
- binding sulfate ion: Y23 (= Y49), W107 (≠ L133), R164 (= R189), H257 (= H300), R260 (= R303)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
37% identity, 93% coverage: 28:401/403 of query aligns to 5:359/360 of 2rduA
- active site: S106 (= S131), Y130 (= Y154), T156 (= T180), D158 (= D182), K234 (= K276), H258 (= H300)
- binding flavin mononucleotide: Y24 (= Y49), Y25 (≠ I50), A77 (≠ P102), T78 (= T103), A79 (= A104), S106 (= S131), Q128 (= Q152), Y130 (= Y154), T156 (= T180), K234 (= K276), H258 (= H300), G259 (= G301), R261 (= R303), D289 (= D331), G290 (= G332), G291 (= G333), R293 (≠ Q335), G312 (= G354), R313 (= R355)
- binding glyoxylic acid: Y24 (= Y49), W108 (≠ L133), Y130 (= Y154), R165 (= R189), H258 (= H300), R261 (= R303)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
36% identity, 93% coverage: 28:401/403 of query aligns to 6:351/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y49), A80 (= A104), M81 (≠ L105), W109 (≠ L133), Y131 (= Y154), R166 (= R189), M182 (≠ L205), H250 (= H300), R253 (= R303)
- binding flavin mononucleotide: Y25 (= Y49), Y26 (≠ I50), A78 (≠ P102), T79 (= T103), A80 (= A104), S107 (= S131), W109 (≠ L133), Q129 (= Q152), Y131 (= Y154), T157 (= T180), K226 (= K276), H250 (= H300), G251 (= G301), R253 (= R303), D281 (= D331), G282 (= G332), R285 (≠ Q335), G304 (= G354), R305 (= R355)
1al8A Three-dimensional structure of glycolate oxidase with bound active- site inhibitors (see paper)
36% identity, 93% coverage: 27:400/403 of query aligns to 2:339/344 of 1al8A
- active site: S106 (= S131), Y129 (= Y154), T155 (= T180), D157 (= D182), K215 (= K276), H239 (= H300)
- binding 3-decyl-2,5-dioxo-4-hydroxy-3-pyrroline: Y24 (= Y49), W108 (≠ L133), Y129 (= Y154), F166 (= F197), H239 (= H300), R242 (= R303)
- binding flavin mononucleotide: Y25 (≠ I50), P77 (= P102), T78 (= T103), A79 (= A104), S106 (= S131), Q127 (= Q152), Y129 (= Y154), T155 (= T180), K215 (= K276), H239 (= H300), R242 (= R303), D270 (= D331), G271 (= G332), R274 (≠ Q335), G293 (= G354), R294 (= R355)
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
33% identity, 93% coverage: 26:401/403 of query aligns to 1:371/373 of 6bfgA
- active site: Y129 (= Y154), D156 (= D182), H272 (= H300)
- binding flavin mononucleotide: Y24 (= Y49), P77 (= P102), T78 (= T103), G79 (≠ A104), Q127 (= Q152), Y129 (= Y154), T154 (= T180), K248 (= K276), H272 (= H300), G273 (= G301), R275 (= R303), D301 (= D331), S302 (≠ G332), G303 (= G333), R305 (≠ Q335), G324 (= G354), R325 (= R355)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
33% identity, 93% coverage: 26:401/403 of query aligns to 3:373/393 of P20932
- PTG 79:81 (≠ PTA 102:104) binding
- G81 (≠ A104) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S131) binding
- Q129 (= Q152) binding
- T156 (= T180) binding
- K250 (= K276) binding
- DSGFR 303:307 (≠ DGGVQ 331:335) binding
- GR 326:327 (= GR 354:355) binding
2w0uA Crystal structure of human glycolate oxidase in complex with the inhibitor 5-[(4-chlorophenyl)sulfanyl]- 1,2,3-thiadiazole-4- carboxylate. (see paper)
35% identity, 93% coverage: 28:401/403 of query aligns to 3:332/334 of 2w0uA
- active site: S104 (= S131), Y128 (= Y154), T154 (= T180), D156 (= D182), K207 (= K276), H231 (= H300)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y22 (= Y49), M78 (≠ L105), W106 (≠ L133), Y128 (= Y154), R163 (= R189), L176 (≠ I245), Y179 (= Y248), V180 (≠ F249), H231 (= H300), R234 (= R303)
- binding flavin mononucleotide: Y23 (≠ I50), A75 (≠ P102), T76 (= T103), A77 (= A104), S104 (= S131), Q126 (= Q152), T154 (= T180), K207 (= K276), H231 (= H300), G232 (= G301), R234 (= R303), D262 (= D331), G263 (= G332), R266 (≠ Q335), G285 (= G354), R286 (= R355)
6w4cA Crystal structure of hao1 in complex with indazole acid inhibitor - compound 5 (see paper)
35% identity, 93% coverage: 28:401/403 of query aligns to 6:335/336 of 6w4cA
- active site: Y131 (= Y154), D159 (= D182), H234 (= H300)
- binding flavin mononucleotide: Y25 (= Y49), Y26 (≠ I50), A78 (≠ P102), T79 (= T103), A80 (= A104), S107 (= S131), Q129 (= Q152), Y131 (= Y154), T157 (= T180), K210 (= K276), H234 (= H300), G235 (= G301), R237 (= R303), D265 (= D331), G266 (= G332), R269 (≠ Q335), G288 (= G354), R289 (= R355)
- binding 5-[[3-[3-(dimethylamino)-1,2,4-oxadiazol-5-yl]-2-oxidanyl-phenyl]methylamino]-2~{H}-indazole-3-carboxylic acid: Y25 (= Y49), A80 (= A104), M81 (≠ L105), M84 (≠ L108), W109 (≠ L133), Y131 (= Y154), R166 (= R189), A180 (≠ S246), V183 (≠ F249), H234 (= H300), R237 (= R303)
7m2oA Crystal structure of human glycolate oxidase with inhibitor compound 15
35% identity, 93% coverage: 28:401/403 of query aligns to 8:333/335 of 7m2oA
- binding flavin mononucleotide: A80 (≠ P102), T81 (= T103), A82 (= A104), S109 (= S131), Q131 (= Q152), Y133 (= Y154), T159 (= T180), K208 (= K276), H232 (= H300), G233 (= G301), R235 (= R303), D263 (= D331), G264 (= G332), R267 (≠ Q335), G286 (= G354), R287 (= R355)
- binding 5-[(5'-{1-(4-carboxy-1,3-thiazol-2-yl)-5-(cyclopropylmethyl)-4-[(3-fluoro-4-sulfamoylphenyl)methyl]-1H-pyrazol-3-yl}-2'-fluoro[1,1'-biphenyl]-4-yl)oxy]-1H-1,2,3-triazole-4-carboxylic acid: Y27 (= Y49), A82 (= A104), M83 (≠ L105), W111 (≠ L133), A112 (≠ G134), T113 (= T135), S114 (≠ V136), S115 (= S137), Y133 (= Y154), Y135 (≠ H156), R168 (= R189), L177 (≠ I245), Y180 (= Y248), H232 (= H300), R235 (= R303)
2rdtA Crystal structure of human glycolate oxidase (go) in complex with cdst (see paper)
35% identity, 93% coverage: 28:401/403 of query aligns to 8:333/335 of 2rdtA
- active site: S109 (= S131), Y133 (= Y154), T159 (= T180), D161 (= D182), K208 (= K276), H232 (= H300)
- binding 5-(dodecylthio)-1H-1,2,3-triazole-4-carboxylic acid: Y27 (= Y49), M83 (≠ L105), W111 (≠ L133), Y133 (= Y154), R168 (= R189), H232 (= H300), R235 (= R303)
- binding flavin mononucleotide: Y27 (= Y49), Y28 (≠ I50), A80 (≠ P102), T81 (= T103), A82 (= A104), S109 (= S131), Q131 (= Q152), Y133 (= Y154), T159 (= T180), K208 (= K276), H232 (= H300), G233 (= G301), R235 (= R303), D263 (= D331), G264 (= G332), G265 (= G333), R267 (≠ Q335), G286 (= G354), R287 (= R355)
Query Sequence
>SMc01712 FitnessBrowser__Smeli:SMc01712
MISSSRLIEKVLLIRPFGFEGQMRLKDCYNFHDFRRMAKRRLPSPIFNYIDGAADDEVTY
RRNTAAFEGCDLVPNVLRGVGDVDMSVTVMGQRLAMPVYCSPTALQRLFHHQGERAVAAA
AAKFGTMFGVSSLGTVSLEEARRICDGPQVYQFYFHKDRGLNREMMARAKQAGIEVMMLT
VDSITGGNRERDKRTGFAIPFKLNLAGITQFAIKPSWAVNYVRHEPFRLPQLENHVDMGR
GAMSISRYFTEMLDPSMSWDDVAEMVQHWGGQFCLKGVISVEDAKRAVEIGCTGIVLSNH
GGRQLDGSRTAFDQLDEIVQAVGDRIDVMMDGGVQRGTHVLKALSLGAKAVGLGRYYLFP
LAAAGQAGVERALELMRVEIERGMKLMGCSSVDELTKENLRFR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory