SitesBLAST
Comparing SMc01740 FitnessBrowser__Smeli:SMc01740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6w4cA Crystal structure of hao1 in complex with indazole acid inhibitor - compound 5 (see paper)
39% identity, 91% coverage: 13:343/364 of query aligns to 7:332/336 of 6w4cA
- active site: Y131 (= Y142), D159 (= D170), H234 (= H245)
- binding flavin mononucleotide: Y25 (≠ S37), Y26 (≠ L38), A78 (≠ P90), T79 (= T91), A80 (≠ G92), S107 (= S119), Q129 (= Q140), Y131 (= Y142), T157 (= T168), K210 (= K221), H234 (= H245), G235 (= G246), R237 (= R248), D265 (= D276), G266 (= G277), R269 (≠ C280), G288 (= G299), R289 (= R300)
- binding 5-[[3-[3-(dimethylamino)-1,2,4-oxadiazol-5-yl]-2-oxidanyl-phenyl]methylamino]-2~{H}-indazole-3-carboxylic acid: Y25 (≠ S37), A80 (≠ G92), M81 (≠ P93), M84 (≠ L96), W109 (≠ G121), Y131 (= Y142), R166 (= R177), A180 (≠ G191), V183 (≠ P194), H234 (= H245), R237 (= R248)
2w0uA Crystal structure of human glycolate oxidase in complex with the inhibitor 5-[(4-chlorophenyl)sulfanyl]- 1,2,3-thiadiazole-4- carboxylate. (see paper)
39% identity, 91% coverage: 13:343/364 of query aligns to 4:329/334 of 2w0uA
- active site: S104 (= S119), Y128 (= Y142), T154 (= T168), D156 (= D170), K207 (= K221), H231 (= H245)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y22 (≠ S37), M78 (≠ P93), W106 (≠ G121), Y128 (= Y142), R163 (= R177), L176 (= L190), Y179 (≠ W193), V180 (≠ P194), H231 (= H245), R234 (= R248)
- binding flavin mononucleotide: Y23 (≠ L38), A75 (≠ P90), T76 (= T91), A77 (≠ G92), S104 (= S119), Q126 (= Q140), T154 (= T168), K207 (= K221), H231 (= H245), G232 (= G246), R234 (= R248), D262 (= D276), G263 (= G277), R266 (≠ C280), G285 (= G299), R286 (= R300)
7r4pA Structure of human hydroxyacid oxidase 1 bound with 6-amino-1-benzyl- 5-(methylamino)pyrimidine-2,4(1h,3h)-dione
39% identity, 91% coverage: 13:343/364 of query aligns to 6:333/337 of 7r4pA
- binding flavin mononucleotide: Y25 (≠ L38), A77 (≠ P90), T78 (= T91), A79 (≠ G92), S106 (= S119), Q128 (= Q140), Y130 (= Y142), T156 (= T168), K211 (= K221), H235 (= H245), G236 (= G246), R238 (= R248), D266 (= D276), G267 (= G277), R270 (≠ C280), G289 (= G299), R290 (= R300)
- binding 6-amino-1-benzyl-5-(methylamino)pyrimidine-2,4(1H,3H)-dione: Y24 (≠ S37), A79 (≠ G92), M80 (≠ P93), W108 (≠ G121), Y130 (= Y142), R165 (= R177), L180 (= L190), H235 (= H245), R238 (= R248)
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
38% identity, 91% coverage: 13:343/364 of query aligns to 6:337/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ L38), A77 (≠ P90), T78 (= T91), A79 (≠ G92), S106 (= S119), Q128 (= Q140), Y130 (= Y142), K215 (= K221), H239 (= H245), G240 (= G246), R242 (= R248), D270 (= D276), G271 (= G277), R274 (≠ C280), G293 (= G299), R294 (= R300)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ R144), K133 (≠ G145), D134 (= D146), N183 (≠ G189), K190 (≠ Q196)
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
38% identity, 91% coverage: 13:343/364 of query aligns to 5:340/344 of 5qihA
- active site: Y129 (= Y142), D157 (= D170), H242 (= H245)
- binding flavin mononucleotide: Y23 (≠ S37), Y24 (≠ L38), A76 (≠ P90), T77 (= T91), A78 (≠ G92), S105 (= S119), Q127 (= Q140), Y129 (= Y142), K218 (= K221), H242 (= H245), G243 (= G246), R245 (= R248), D273 (= D276), G274 (= G277), R277 (≠ C280), G296 (= G299), R297 (= R300)
- binding 1-methylindazole-3-carboxamide: Y23 (≠ S37), A78 (≠ G92), M79 (≠ P93), W107 (≠ G121), Y129 (= Y142), M180 (vs. gap), L187 (= L190), H242 (= H245)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
38% identity, 91% coverage: 13:343/364 of query aligns to 5:340/344 of 5qidA
- active site: Y129 (= Y142), D157 (= D170), H242 (= H245)
- binding flavin mononucleotide: Y23 (≠ S37), Y24 (≠ L38), A76 (≠ P90), T77 (= T91), A78 (≠ G92), S105 (= S119), Q127 (= Q140), Y129 (= Y142), K218 (= K221), H242 (= H245), G243 (= G246), R245 (= R248), D273 (= D276), G274 (= G277), R277 (≠ C280), G296 (= G299), R297 (= R300)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ V71), E320 (≠ D323), R323 (≠ L326)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
38% identity, 91% coverage: 13:343/364 of query aligns to 5:340/344 of 5qicA
- active site: Y129 (= Y142), D157 (= D170), H242 (= H245)
- binding flavin mononucleotide: Y23 (≠ S37), Y24 (≠ L38), A76 (≠ P90), T77 (= T91), A78 (≠ G92), S105 (= S119), Q127 (= Q140), Y129 (= Y142), K218 (= K221), H242 (= H245), G243 (= G246), R245 (= R248), D273 (= D276), G274 (= G277), R277 (≠ C280), G296 (= G299), R297 (= R300)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ R144), K132 (≠ G145), V136 (≠ S149), M180 (vs. gap), F183 (vs. gap), Y190 (≠ W193), K193 (≠ Q196), A194 (= A197)
5qibA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with fmopl000388a
38% identity, 91% coverage: 13:343/364 of query aligns to 5:340/344 of 5qibA
- active site: Y129 (= Y142), D157 (= D170), H242 (= H245)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: Y23 (≠ S37), Y24 (≠ L38), A76 (≠ P90), T77 (= T91), A78 (≠ G92), S105 (= S119), Q127 (= Q140), Y129 (= Y142), K218 (= K221), H242 (= H245), G243 (= G246), R245 (= R248), D273 (= D276), G274 (= G277), G275 (= G278), R277 (≠ C280), G296 (= G299), R297 (= R300)
- binding 5-(cyclohexylamino)pyrimidine-2,4(1H,3H)-dione: Y23 (≠ S37), M79 (≠ P93), W107 (≠ G121), Y129 (= Y142), R164 (= R177), M180 (vs. gap), L187 (= L190), H242 (= H245), R245 (= R248)
7m2oA Crystal structure of human glycolate oxidase with inhibitor compound 15
39% identity, 91% coverage: 13:343/364 of query aligns to 9:330/335 of 7m2oA
- binding flavin mononucleotide: A80 (≠ P90), T81 (= T91), A82 (≠ G92), S109 (= S119), Q131 (= Q140), Y133 (= Y142), T159 (= T168), K208 (= K221), H232 (= H245), G233 (= G246), R235 (= R248), D263 (= D276), G264 (= G277), R267 (≠ C280), G286 (= G299), R287 (= R300)
- binding 5-[(5'-{1-(4-carboxy-1,3-thiazol-2-yl)-5-(cyclopropylmethyl)-4-[(3-fluoro-4-sulfamoylphenyl)methyl]-1H-pyrazol-3-yl}-2'-fluoro[1,1'-biphenyl]-4-yl)oxy]-1H-1,2,3-triazole-4-carboxylic acid: Y27 (≠ S37), A82 (≠ G92), M83 (≠ P93), W111 (≠ G121), A112 (≠ C122), T113 (= T123), S114 (≠ P124), S115 (vs. gap), Y133 (= Y142), Y135 (≠ R144), R168 (= R177), L177 (= L190), Y180 (≠ W193), H232 (= H245), R235 (= R248)
2rdtA Crystal structure of human glycolate oxidase (go) in complex with cdst (see paper)
39% identity, 91% coverage: 13:343/364 of query aligns to 9:330/335 of 2rdtA
- active site: S109 (= S119), Y133 (= Y142), T159 (= T168), D161 (= D170), K208 (= K221), H232 (= H245)
- binding 5-(dodecylthio)-1H-1,2,3-triazole-4-carboxylic acid: Y27 (≠ S37), M83 (≠ P93), W111 (≠ G121), Y133 (= Y142), R168 (= R177), H232 (= H245), R235 (= R248)
- binding flavin mononucleotide: Y27 (≠ S37), Y28 (≠ L38), A80 (≠ P90), T81 (= T91), A82 (≠ G92), S109 (= S119), Q131 (= Q140), Y133 (= Y142), T159 (= T168), K208 (= K221), H232 (= H245), G233 (= G246), R235 (= R248), D263 (= D276), G264 (= G277), G265 (= G278), R267 (≠ C280), G286 (= G299), R287 (= R300)
6w44A Crystal structure of hao1 in complex with indazole acid inhibitor - compound 4 (see paper)
39% identity, 91% coverage: 13:343/364 of query aligns to 6:326/330 of 6w44A
- active site: Y130 (= Y142), D158 (= D170), H228 (= H245)
- binding flavin mononucleotide: Y24 (≠ S37), A77 (≠ P90), T78 (= T91), A79 (≠ G92), S106 (= S119), Q128 (= Q140), Y130 (= Y142), K204 (= K221), H228 (= H245), G229 (= G246), R231 (= R248), D259 (= D276), G260 (= G277), R263 (≠ C280), G282 (= G299), R283 (= R300)
- binding 5-[methyl-[(2-propoxypyridin-3-yl)methyl]amino]-2~{H}-indazole-3-carboxylic acid: Y24 (≠ S37), A79 (≠ G92), M80 (≠ P93), W108 (≠ G121), Y130 (= Y142), R165 (= R177), L173 (= L190), A174 (≠ G191), V177 (≠ P194), H228 (= H245), R231 (= R248)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
37% identity, 91% coverage: 13:343/364 of query aligns to 7:348/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (≠ S37), A80 (≠ G92), M81 (≠ P93), W109 (≠ G121), Y131 (= Y142), R166 (= R177), M182 (vs. gap), H250 (= H245), R253 (= R248)
- binding flavin mononucleotide: Y25 (≠ S37), Y26 (≠ L38), A78 (≠ P90), T79 (= T91), A80 (≠ G92), S107 (= S119), W109 (≠ G121), Q129 (= Q140), Y131 (= Y142), T157 (= T168), K226 (= K221), H250 (= H245), G251 (= G246), R253 (= R248), D281 (= D276), G282 (= G277), R285 (≠ C280), G304 (= G299), R305 (= R300)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
37% identity, 91% coverage: 13:343/364 of query aligns to 5:349/353 of 5qieA
- active site: Y129 (= Y142), D157 (= D170), H251 (= H245)
- binding flavin mononucleotide: Y23 (≠ S37), Y24 (≠ L38), A76 (≠ P90), T77 (= T91), A78 (≠ G92), S105 (= S119), Q127 (= Q140), Y129 (= Y142), K227 (= K221), H251 (= H245), G252 (= G246), R254 (= R248), D282 (= D276), G283 (= G277), R286 (≠ C280), G305 (= G299), R306 (= R300)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: D322 (≠ R316)
Sites not aligning to the query:
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
38% identity, 88% coverage: 26:345/364 of query aligns to 12:348/353 of 5zbmB
- active site: Y128 (= Y142), D156 (= D170), H248 (= H245)
- binding flavin mononucleotide: Y23 (≠ S37), Y24 (≠ L38), P76 (= P90), T77 (= T91), W107 (≠ G121), Q126 (= Q140), Y128 (= Y142), T154 (= T168), K224 (= K221), H248 (= H245), G249 (= G246), R251 (= R248), D279 (= D276), G280 (= G277), R283 (≠ C280), G302 (= G299), R303 (= R300)
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
38% identity, 88% coverage: 26:345/364 of query aligns to 13:345/350 of 1al7A
- active site: S106 (= S119), Y129 (= Y142), T155 (= T168), D157 (= D170), K221 (= K221), H245 (= H245)
- binding flavin mononucleotide: Y24 (≠ S37), Y25 (≠ L38), P77 (= P90), T78 (= T91), A79 (≠ G92), S106 (= S119), Q127 (= Q140), T155 (= T168), K221 (= K221), H245 (= H245), R248 (= R248), D276 (= D276), G277 (= G277), R280 (≠ C280), G299 (= G299), R300 (= R300)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (≠ S37), W108 (≠ G121), Y129 (= Y142), R164 (= R177), F172 (≠ H185), I198 (≠ Y198), H245 (= H245), R248 (= R248)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
37% identity, 91% coverage: 13:343/364 of query aligns to 8:356/360 of 6gmcA
- active site: Y132 (= Y142), D160 (= D170), H258 (= H245)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (≠ S37), M82 (≠ P93), W110 (≠ G121), Y132 (= Y142), R167 (= R177), F191 (vs. gap), L203 (= L190), Y206 (≠ W193), H258 (= H245), R261 (= R248)
- binding flavin mononucleotide: Y26 (≠ S37), Y27 (≠ L38), A79 (≠ P90), T80 (= T91), A81 (≠ G92), S108 (= S119), Q130 (= Q140), Y132 (= Y142), T158 (= T168), K234 (= K221), H258 (= H245), G259 (= G246), R261 (= R248), D289 (= D276), G290 (= G277), R293 (≠ C280), G312 (= G299), R313 (= R300)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
36% identity, 91% coverage: 13:343/364 of query aligns to 8:358/370 of Q9UJM8
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
36% identity, 91% coverage: 13:343/364 of query aligns to 8:358/362 of 6gmbA
- active site: Y132 (= Y142), D160 (= D170), H260 (= H245)
- binding flavin mononucleotide: Y26 (≠ S37), Y27 (≠ L38), A79 (≠ P90), T80 (= T91), A81 (≠ G92), S108 (= S119), Q130 (= Q140), Y132 (= Y142), K236 (= K221), H260 (= H245), G261 (= G246), R263 (= R248), D291 (= D276), G292 (= G277), G293 (= G278), R295 (≠ C280), G314 (= G299), R315 (= R300)
- binding glycolic acid: Y26 (≠ S37), W110 (≠ G121), Y132 (= Y142), R167 (= R177), H260 (= H245), R263 (= R248)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
36% identity, 91% coverage: 13:343/364 of query aligns to 5:355/359 of 5qigA
- active site: Y129 (= Y142), D157 (= D170), H257 (= H245)
- binding flavin mononucleotide: Y23 (≠ S37), Y24 (≠ L38), A76 (≠ P90), T77 (= T91), A78 (≠ G92), S105 (= S119), Q127 (= Q140), Y129 (= Y142), T155 (= T168), K233 (= K221), H257 (= H245), G258 (= G246), R260 (= R248), D288 (= D276), G289 (= G277), G290 (= G278), R292 (≠ C280), G311 (= G299), R312 (= R300)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: R223 (≠ K211), G248 (= G236), F320 (≠ A308), K324 (≠ A312), D328 (≠ R316)
Sites not aligning to the query:
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
36% identity, 91% coverage: 13:343/364 of query aligns to 5:355/359 of 5qifA
- active site: Y129 (= Y142), D157 (= D170), H257 (= H245)
- binding flavin mononucleotide: Y23 (≠ S37), Y24 (≠ L38), A76 (≠ P90), T77 (= T91), A78 (≠ G92), S105 (= S119), Q127 (= Q140), Y129 (= Y142), K233 (= K221), H257 (= H245), G258 (= G246), R260 (= R248), D288 (= D276), G289 (= G277), R292 (≠ C280), G311 (= G299), R312 (= R300)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (≠ K211), R224 (≠ D212), S227 (≠ D215)
Query Sequence
>SMc01740 FitnessBrowser__Smeli:SMc01740
MSKGEEATCPPHLGDFESLQEIIQKAQGALPKEKWDSLVGGAETETTLKRNRLAIDSIAF
KPRVLRNVSVVDLSIEHFGRRLRLPIFLAPTGPLNLFGPGGGAAVASGAQVFGVAHMLSS
GCTPLESVAEAAPSALRMAQLYVRGDDASVHKYVGRALASGCAAICLTVDSAVLARRDRD
IANRHRTAGLGKWPGQAYQAGLDWRTVKLIKDSYDIPLVLKGIATVEDARIAVDHGVDWI
YVSNHGGRQLDHGRGTMDVLPEIIDAVGGQAKVMVDGGFCRGTDIIKALAIGANLVGLGR
MQCYALAAGGEAAIIRMLELIEDEMLRSMALLGVPTIGDLDRSYLYPAVPVTIPSALSAF
PLIN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory