Comparing SMc01802 FitnessBrowser__Smeli:SMc01802 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
49% identity, 98% coverage: 7:318/318 of query aligns to 11:321/323 of 4dz4B
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
44% identity, 84% coverage: 45:310/318 of query aligns to 26:291/294 of 7lolA
7lbaB E. Coli agmatinase (see paper)
44% identity, 84% coverage: 45:310/318 of query aligns to 43:308/310 of 7lbaB
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
44% identity, 84% coverage: 45:310/318 of query aligns to 36:301/306 of P60651
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
43% identity, 84% coverage: 45:310/318 of query aligns to 22:281/284 of 7loxA
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
41% identity, 90% coverage: 22:306/318 of query aligns to 10:302/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
41% identity, 90% coverage: 22:306/318 of query aligns to 2:294/301 of 1gq6B
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
38% identity, 93% coverage: 18:314/318 of query aligns to 9:313/316 of 3nipB
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
38% identity, 93% coverage: 18:314/318 of query aligns to 8:312/315 of 3niqA
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
38% identity, 93% coverage: 18:314/318 of query aligns to 11:315/318 of Q9I6K2
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
37% identity, 90% coverage: 22:306/318 of query aligns to 15:310/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
37% identity, 90% coverage: 22:306/318 of query aligns to 12:307/316 of 3nioA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
36% identity, 82% coverage: 43:302/318 of query aligns to 22:276/284 of Q57757
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
28% identity, 88% coverage: 22:301/318 of query aligns to 52:346/378 of 7esrA
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
28% identity, 81% coverage: 45:301/318 of query aligns to 8:263/276 of 3lhlA
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
30% identity, 87% coverage: 30:305/318 of query aligns to 8:282/293 of 3pzlB
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 81% coverage: 46:302/318 of query aligns to 67:333/342 of P46637
Sites not aligning to the query:
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
29% identity, 81% coverage: 46:302/318 of query aligns to 43:309/318 of 6vsuE
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
29% identity, 89% coverage: 24:306/318 of query aligns to 7:295/303 of 1wogA
2ef5A Crystal structure of the arginase from thermus thermophilus
28% identity, 83% coverage: 46:309/318 of query aligns to 5:271/273 of 2ef5A
>SMc01802 FitnessBrowser__Smeli:SMc01802
MANKSIDHAITAKSLTTAASDPTHAGILSFMRRKYTKELKGVEAVVWGIPFDAATSNRPG
ARFGPQAIRRASAIFDNDPQYPFQRDLFADMATIDYGDCLLDYGNHARTPQTIEREASKI
LKSGAYLLTLGGDHFVTYPILRAHAALHGPLALVQFDAHQDTWPDEKGRIDHGAFVGRAA
REGLIDVERSIQIGIRTHAPEDCGIRIVYGYELEEMRAEEIADTIIRHVDNRPAYLTFDI
DCLDPAFAPGTGTPVAGGPSSAKILSVLRKLGALHIAGSDVVEVAPAYDHADLTAIAGST
IAMYMLGLRAEWLAERRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory