SitesBLAST
Comparing SMc01809 FitnessBrowser__Smeli:SMc01809 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7kb1C Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
56% identity, 99% coverage: 6:426/426 of query aligns to 6:426/428 of 7kb1C
- binding pyridoxal-5'-phosphate: Y57 (= Y56), R59 (= R58)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: G87 (= G86), Q88 (≠ H87), Y112 (= Y111), N160 (= N158), D185 (= D183), S206 (= S205), T208 (= T207), K209 (= K208), N369 (= N369), I370 (= I370), R404 (= R404)
7kb1A Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
56% identity, 99% coverage: 6:426/426 of query aligns to 6:426/428 of 7kb1A
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: Y57 (= Y56), R59 (= R58), G87 (= G86), Q88 (≠ H87), Y112 (= Y111), N160 (= N158), D185 (= D183), S206 (= S205), T208 (= T207), K209 (= K208), N369 (= N369), I370 (= I370), R404 (= R404)
2ctzA Crystal structure of o-acetyl homoserine sulfhydrylase from thermus thermophilus hb8
54% identity, 98% coverage: 7:423/426 of query aligns to 3:420/421 of 2ctzA
- active site: R54 (= R58), Y107 (= Y111), D180 (= D183), K206 (= K208)
- binding pyridoxal-5'-phosphate: S81 (= S85), G82 (= G86), H83 (= H87), Q86 (= Q90), Y107 (= Y111), D180 (= D183), T182 (= T185), S203 (= S205), T205 (= T207), K206 (= K208)
Q5SK88 O-acetyl-L-homoserine sulfhydrylase 1; OAH-sulfhydrylase 1; EC 2.5.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
54% identity, 98% coverage: 7:423/426 of query aligns to 3:420/421 of Q5SK88
- K206 (= K208) modified: N6-(pyridoxal phosphate)lysine
8wkoA Crystal structure of o-acetylhomoserine sulfhydrylase from lactobacillus plantarum in the closed form
51% identity, 98% coverage: 7:425/426 of query aligns to 9:424/425 of 8wkoA
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: G87 (= G86), S88 (≠ H87), Y112 (= Y111), E155 (= E154), D184 (= D183), T186 (= T185), S206 (= S205), A207 (≠ L206), T208 (= T207), F209 (= F209), G212 (= G212), M217 (= M217), V369 (≠ I370), A370 (≠ G371)
- binding proline: H213 (= H213), Q284 (≠ T285), S288 (≠ T289)
O13326 Homocysteine synthase; O-acetylhomoserine sulfhydrylase; OAH SHL; OAH sulfhydrylase; EC 2.5.1.49 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
51% identity, 98% coverage: 7:423/426 of query aligns to 8:426/429 of O13326
- G411 (= G408) mutation to D: Impairs homocysteine synthase activity.
8erbK Crystal structure of fub7 in complex with vinylglycine ketimine (see paper)
49% identity, 99% coverage: 7:426/426 of query aligns to 6:427/429 of 8erbK
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: Y55 (= Y56), R57 (= R58), G85 (= G86), Q86 (≠ H87), Q89 (= Q90), Y110 (= Y111), N157 (= N158), D182 (= D183), S205 (= S205), T207 (= T207), K208 (= K208), T385 (= T384), R405 (= R404)
8erjB Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
49% identity, 99% coverage: 7:426/426 of query aligns to 5:426/428 of 8erjB
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]but-3-enoic acid: G84 (= G86), Q85 (≠ H87), Q88 (= Q90), Y109 (= Y111), D181 (= D183), S204 (= S205), K207 (= K208), A368 (= A368), N369 (= N369), T384 (= T384), R404 (= R404)
8erjA Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
49% identity, 99% coverage: 7:426/426 of query aligns to 5:426/428 of 8erjA
- binding (2E)-2-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid: S83 (= S85), G84 (= G86), Q85 (≠ H87), Q88 (= Q90), Y109 (= Y111), N156 (= N158), D181 (= D183), S204 (= S205), T206 (= T207), K207 (= K208), R404 (= R404)
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
43% identity, 99% coverage: 6:426/426 of query aligns to 7:395/396 of 4hf8A
- active site: R59 (= R58), Y112 (= Y111), D184 (= D183), K209 (= K208)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G86), I88 (≠ H87), Y112 (= Y111), E155 (= E154), N159 (= N158), D184 (= D183), S206 (= S205), K209 (= K208), S338 (≠ N369), R373 (= R404)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
43% identity, 99% coverage: 6:426/426 of query aligns to 7:395/396 of 4omaA
- active site: R59 (= R58), Y112 (= Y111), D184 (= D183), K209 (= K208)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G86), I88 (≠ H87), Y112 (= Y111), D184 (= D183), S206 (= S205), T208 (= T207), K209 (= K208), V337 (≠ A368), S338 (≠ N369), R373 (= R404)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
43% identity, 99% coverage: 6:426/426 of query aligns to 7:395/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
43% identity, 99% coverage: 6:426/426 of query aligns to 7:395/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
43% identity, 99% coverage: 6:426/426 of query aligns to 7:395/396 of 3jw9A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
43% identity, 99% coverage: 6:426/426 of query aligns to 6:394/395 of 5m3zA
- active site: R58 (= R58), Y111 (= Y111), D183 (= D183), K208 (= K208)
- binding norleucine: Y111 (= Y111), H113 (≠ G113), K208 (= K208), V336 (≠ A368), S337 (≠ N369)
- binding pyridoxal-5'-phosphate: G86 (= G86), I87 (≠ H87), Y111 (= Y111), E154 (= E154), D183 (= D183), T185 (= T185), S205 (= S205), T207 (= T207), K208 (= K208)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G86), I87 (≠ H87), Y111 (= Y111), D183 (= D183), S205 (= S205), T207 (= T207), K208 (= K208), V336 (≠ A368), S337 (≠ N369), R372 (= R404)
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
43% identity, 99% coverage: 6:426/426 of query aligns to 7:395/396 of 6egrA
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
41% identity, 99% coverage: 6:426/426 of query aligns to 7:384/386 of 3mkjA
- active site: Y101 (= Y111), D173 (= D183), K198 (= K208)
- binding [5-hydroxy-4-(iminomethyl)-6-methyl-pyridin-3-yl]methyl dihydrogen phosphate: G76 (= G86), I77 (≠ H87), Y101 (= Y111), E144 (= E154), D173 (= D183), F176 (≠ M186), S195 (= S205), T197 (= T207), K198 (= K208)
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
40% identity, 98% coverage: 5:423/426 of query aligns to 8:394/398 of 1pg8A
- active site: R61 (= R58), Y114 (= Y111), D186 (= D183), K211 (= K208)
- binding pyridoxal-5'-phosphate: Y59 (= Y56), R61 (= R58), S88 (= S85), G89 (= G86), M90 (≠ H87), Y114 (= Y111), D186 (= D183), S208 (= S205), T210 (= T207), K211 (= K208)
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
40% identity, 98% coverage: 5:423/426 of query aligns to 8:394/398 of P13254
- YSR 59:61 (≠ YTR 56:58) binding
- R61 (= R58) mutation R->A,E,F: Loss of elimination activity against L-methionine.
- GM 89:90 (≠ GH 86:87) binding in other chain
- Y114 (= Y111) binding
- C116 (≠ G113) mutation to H: Drastic decrease of the catalytic efficiency of the elimination reaction with L-methionine, by 6700-fold, and increases that with L-cysteine by 7-fold, mainly due to changes in kcat. Loss of ability to catalyze replacement reaction between L-methionine and 2-mercaptoethanol.; mutation to S: 9% of wild-type elimination activity against L-methionine.; mutation to T: 40% of wild-type elimination activity against L-methionine.
- SAT 208:210 (≠ SLT 205:207) binding in other chain
- K211 (= K208) modified: N6-(pyridoxal phosphate)lysine
- K240 (≠ R269) mutation K->D,E: Marked decrease in elimination activity against both L-methionine and DL-homocysteine.; mutation to M: 50% reduction in alpha,gamma-elimination activity against DL-homocysteine, while retaining elimination activity against L-methionine and L-cysteine.
- D241 (= D270) mutation D->H,R: 5 to 14-fold reduction in alpha,gamma-elimination activity against L-methionine, while no change in affinity for L-methionine.
- R375 (= R404) binding
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
40% identity, 98% coverage: 5:423/426 of query aligns to 2:388/392 of 5x2xA
- active site: R55 (= R58), Y108 (= Y111), D180 (= D183), K205 (= K208)
- binding (2E)-2-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid: Y53 (= Y56), R55 (= R58), G83 (= G86), M84 (≠ H87), Y108 (= Y111), N155 (= N158), D180 (= D183), S202 (= S205), T204 (= T207), K205 (= K208), V333 (≠ A368), S334 (≠ N369), R369 (= R404)
Query Sequence
>SMc01809 FitnessBrowser__Smeli:SMc01809
MKAGPGFSTLAIHAGAQPDPTTGARATPIYQTTSFVFNDTDHAAALFGLQQFGNIYTRIM
NPTQAVLEERIAALEGGTAGLAVSSGHAAQLLVFHTIMRPGDNFVSARQLYGGSANQFGH
AFKAFDWQVRWADSAEPESFDAQIDERTKAIFIESLANPGGTFVDIAAIADVARRHGLPL
IVDNTMATPYLMRPLEHGADIVVHSLTKFIGGHGNSMGGIIVDGGTFDWSKSGKYPLLSE
PRPEYGGVVLHQAFGNFAFAIAARVLGLRDFGPAISPFNAFLIQTGVETLPLRMQRHCDN
ALEVAKWLKGHEKVSWVRYSGLEDDPNHALQKRYSPKGAGAVFTFGLAGGYEAGKRFVEA
LEMFSHLANIGDTRSLVIHPASTTHRQLTPEQQVAAGAGPDVIRLSVGIEDVADIIADLE
QALGKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory