SitesBLAST
Comparing SMc01823 FitnessBrowser__Smeli:SMc01823 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
39% identity, 74% coverage: 32:225/263 of query aligns to 46:244/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
39% identity, 74% coverage: 32:225/263 of query aligns to 46:244/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
38% identity, 74% coverage: 32:225/263 of query aligns to 46:244/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S47), G62 (= G48), G64 (= G50), K65 (= K51), S66 (≠ T52), T67 (= T53), Q111 (= Q90), K161 (≠ W140), Q162 (= Q141), S164 (= S143), G166 (= G145), M167 (= M146), Q188 (≠ E167), H221 (= H200)
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 77% coverage: 23:225/263 of query aligns to 14:215/369 of P19566
- L86 (= L94) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P168) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D173) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
37% identity, 77% coverage: 23:225/263 of query aligns to 13:214/374 of 2awnB
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
37% identity, 77% coverage: 23:225/263 of query aligns to 11:212/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S47), G36 (= G48), C37 (= C49), G38 (= G50), K39 (= K51), S40 (≠ T52), T41 (= T53), R126 (≠ K137), A130 (≠ Q141), S132 (= S143), G134 (= G145), Q135 (≠ M146)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
37% identity, 77% coverage: 23:225/263 of query aligns to 13:214/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S47), G38 (= G48), C39 (= C49), G40 (= G50), K41 (= K51), S42 (≠ T52), T43 (= T53), Q81 (= Q90), R128 (≠ K137), A132 (≠ Q141), S134 (= S143), G136 (= G145), Q137 (≠ M146), E158 (= E167), H191 (= H200)
- binding magnesium ion: S42 (≠ T52), Q81 (= Q90)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
37% identity, 77% coverage: 23:225/263 of query aligns to 13:214/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G48), C39 (= C49), G40 (= G50), K41 (= K51), S42 (≠ T52), T43 (= T53), R128 (≠ K137), S134 (= S143), Q137 (≠ M146)
- binding beryllium trifluoride ion: S37 (= S47), G38 (= G48), K41 (= K51), Q81 (= Q90), S134 (= S143), G136 (= G145), H191 (= H200)
- binding magnesium ion: S42 (≠ T52), Q81 (= Q90)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
37% identity, 77% coverage: 23:225/263 of query aligns to 13:214/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (≠ A27), G38 (= G48), C39 (= C49), G40 (= G50), K41 (= K51), S42 (≠ T52), T43 (= T53), R128 (≠ K137), A132 (≠ Q141), S134 (= S143), Q137 (≠ M146)
- binding tetrafluoroaluminate ion: S37 (= S47), G38 (= G48), K41 (= K51), Q81 (= Q90), S134 (= S143), G135 (= G144), G136 (= G145), E158 (= E167), H191 (= H200)
- binding magnesium ion: S42 (≠ T52), Q81 (= Q90)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
37% identity, 77% coverage: 23:225/263 of query aligns to 13:214/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (≠ A27), G38 (= G48), C39 (= C49), G40 (= G50), K41 (= K51), S42 (≠ T52), T43 (= T53), R128 (≠ K137), A132 (≠ Q141), S134 (= S143), Q137 (≠ M146)
- binding magnesium ion: S42 (≠ T52), Q81 (= Q90)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
37% identity, 77% coverage: 23:225/263 of query aligns to 14:215/371 of P68187
- A85 (= A93) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S114) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I122) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ T125) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E127) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S132) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G145) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D166) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
8hplC Lpqy-sugabc in state 1 (see paper)
36% identity, 75% coverage: 20:215/263 of query aligns to 9:205/384 of 8hplC
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 72% coverage: 27:215/263 of query aligns to 19:208/393 of P9WQI3
- H193 (= H200) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 84% coverage: 1:222/263 of query aligns to 7:226/378 of P69874
- C26 (≠ T20) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ S21) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F40) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C49) mutation to T: Loss of ATPase activity and transport.
- L60 (= L55) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V71) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V129) mutation to M: Loss of ATPase activity and transport.
- D172 (= D166) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
8hprD Lpqy-sugabc in state 4 (see paper)
36% identity, 72% coverage: 27:215/263 of query aligns to 18:207/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S47), C40 (= C49), G41 (= G50), K42 (= K51), S43 (≠ T52), T44 (= T53), Q82 (= Q90), R129 (≠ K137), Q133 (= Q141), S135 (= S143), G136 (= G144), G137 (= G145), Q159 (≠ E167), H192 (= H200)
- binding magnesium ion: S43 (≠ T52), Q82 (= Q90)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
36% identity, 72% coverage: 27:215/263 of query aligns to 18:207/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S47), G39 (= G48), G41 (= G50), K42 (= K51), S43 (≠ T52), Q82 (= Q90), Q133 (= Q141), G136 (= G144), G137 (= G145), Q138 (≠ M146), H192 (= H200)
- binding magnesium ion: S43 (≠ T52), Q82 (= Q90)
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 76% coverage: 8:207/263 of query aligns to 1:211/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 76% coverage: 8:207/263 of query aligns to 1:211/230 of 1l2tA
- binding adenosine-5'-triphosphate: Y11 (≠ F18), S40 (= S47), G41 (= G48), S42 (≠ C49), G43 (= G50), K44 (= K51), S45 (≠ T52), T46 (= T53), F138 (= F134), Q145 (= Q141), S147 (= S143), G149 (= G145), Q150 (≠ M146), H204 (= H200)
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 93% coverage: 9:253/263 of query aligns to 4:243/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 93% coverage: 9:253/263 of query aligns to 4:243/353 of 1oxvA
Query Sequence
>SMc01823 FitnessBrowser__Smeli:SMc01823
MTSNPASVVSARNLGLTFETSDGPVNALTGVNLDVVKGDFVSFIGPSGCGKTTFLRVIAD
LEKATAGTISVNGMTPEEARRRRAYGYVFQAAALYPWRTIEKNIALPLEIMGYSSEDRKA
RIERTLELVNLSGFGKKYPWQLSGGMQQRASIARALAFDADLLLMDEPFGALDEIVRDHL
NEQLLKLWARTDKTICFVTHSIPEAVYLSTKIIVMSPRPGRVTDVIESTLPRARPLGIRE
TPEFLEIAHRVREGLRAGHSYDE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory