SitesBLAST
Comparing SMc01869 FitnessBrowser__Smeli:SMc01869 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
29% identity, 55% coverage: 25:265/436 of query aligns to 39:263/444 of Q8NLB7
- D54 (= D40) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (vs. gap) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R93) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
26% identity, 73% coverage: 82:399/436 of query aligns to 143:475/548 of Q9VCA2
Sites not aligning to the query:
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 36% coverage: 75:232/436 of query aligns to 183:326/616 of P36035
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 338 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
24% identity, 82% coverage: 42:398/436 of query aligns to 124:482/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G143), W216 (= W146), Q240 (= Q170), W353 (= W277), Y360 (= Y284), F378 (≠ V298), S381 (≠ G301), E385 (vs. gap), C449 (≠ G364), S469 (≠ F384)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
24% identity, 82% coverage: 42:398/436 of query aligns to 124:482/532 of 8et7A
Sites not aligning to the query:
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
25% identity, 82% coverage: 40:398/436 of query aligns to 123:483/554 of O15245
- L160 (≠ A76) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (= S110) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A149) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ P169) mutation to F: Decreased TEA uptake.
- P283 (= P204) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (≠ S208) to G: in dbSNP:rs4646278
- P341 (≠ H249) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ K250) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (= Y284) mutation to F: Decreased TEA uptake.
- Y376 (≠ F299) mutation to F: Decreased TEA uptake.
- G401 (= G315) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ L322) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (= M334) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (= M356) to I: in dbSNP:rs35956182
- V461 (= V375) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G379) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
Query Sequence
>SMc01869 FitnessBrowser__Smeli:SMc01869
MTDATTSLSPQDGALHRQAVNSPARVLFASLVGTTIEFFDFYVYATAAVIIFPHLFFPAA
DPTSAMLQSLATFSIAFFARPLGAVIFGHFGDRIGRKATLVAALMTMGISTVVIGLLPTY
STIGVVAPLLLALCRFGQGLGLGGEWGGAVLLATENAPEGKRSWYAMFPQLGAPIGFILS
AGTFLILGEVMSEEAFLAWGWRVPFIASVLLVIVGLYVRLKITETPEFQKAIDKHERVEV
PVAAIFRSHKRSLVLGTFVALATFVLFYLMTVFSLSWGTTKLGYSREQFLLVQMTGVVFF
GLMIPVSGILSDRFGRRLVLVLTTIGIGVFGLFMAPLLSSGLGGAFVFSIVGLGLMGLTY
GPIGAALAAPFPTAVRYTGASMTFNLAGIFGASLAPYIATWLATNYSLGHVGYYLLAAAS
ITLVCLLLSNEEEVSG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory