Comparing SMc01949 SMc01949 high-affinity branched-chain amino acid ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 87% coverage: 13:270/295 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 87% coverage: 13:270/295 of query aligns to 4:253/254 of 1g6hA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 89% coverage: 8:271/295 of query aligns to 1:239/240 of 1ji0A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
29% identity, 91% coverage: 13:279/295 of query aligns to 4:259/285 of 4yerA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
27% identity, 87% coverage: 14:270/295 of query aligns to 7:244/375 of 2d62A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 81% coverage: 26:263/295 of query aligns to 18:233/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
26% identity, 79% coverage: 23:256/295 of query aligns to 11:221/240 of 4ymuJ
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 81% coverage: 26:263/295 of query aligns to 19:234/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 81% coverage: 26:263/295 of query aligns to 19:234/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 81% coverage: 26:263/295 of query aligns to 19:234/344 of 3tuiC
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
26% identity, 81% coverage: 13:252/295 of query aligns to 1:218/222 of 8i6rB
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 90% coverage: 24:289/295 of query aligns to 16:250/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 90% coverage: 24:289/295 of query aligns to 16:250/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 90% coverage: 24:289/295 of query aligns to 16:250/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 90% coverage: 24:289/295 of query aligns to 16:250/353 of Q97UY8
1g291 Malk (see paper)
27% identity, 84% coverage: 23:270/295 of query aligns to 13:241/372 of 1g291
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
25% identity, 90% coverage: 14:279/295 of query aligns to 7:239/353 of 1vciA
3d31A Modbc from methanosarcina acetivorans (see paper)
27% identity, 88% coverage: 13:273/295 of query aligns to 1:232/348 of 3d31A
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
27% identity, 83% coverage: 13:256/295 of query aligns to 4:226/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
27% identity, 83% coverage: 13:256/295 of query aligns to 4:226/263 of 7d08B
>SMc01949 SMc01949 high-affinity branched-chain amino acid ABC transporter ATP-binding protein
MAFGTDTMTKDPILKVERLSMRFGGLMAINDFSFEAERGEITALIGPNGAGKTTVFNCIT
GFYKPTMGMITMRQKSGAEFLLERLPDFEITKKAKVARTFQNIRMFSGLTVLENLLVAQH
NKLMRASGYTILGLFGFPAYREASRESIELARHWLEKASLTERADDPAGDLPYGAQRRLE
IARAMCTGPELLCLDEPAAGLNPRESLALNALLQEIRRDTGTSILLIEHDMSVVMEISDH
VVVLEYGQKISDGNPDFVKNDPRVIAAYLGVEDEEVEEVIGEIEEIEGERGGPGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory