Comparing SMc01962 FitnessBrowser__Smeli:SMc01962 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
35% identity, 92% coverage: 1:239/259 of query aligns to 1:236/262 of Q9UYV8
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
34% identity, 98% coverage: 2:256/259 of query aligns to 1:247/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
34% identity, 98% coverage: 2:256/259 of query aligns to 1:247/261 of 3klcA
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
32% identity, 99% coverage: 1:256/259 of query aligns to 2:249/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
32% identity, 99% coverage: 1:256/259 of query aligns to 8:255/269 of 6ypaB
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
36% identity, 96% coverage: 2:249/259 of query aligns to 10:257/263 of 4iztA
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
36% identity, 90% coverage: 2:235/259 of query aligns to 2:235/254 of 4izuA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
36% identity, 96% coverage: 2:249/259 of query aligns to 9:256/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
36% identity, 96% coverage: 2:249/259 of query aligns to 9:256/262 of 5ny7A
Sites not aligning to the query:
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
36% identity, 90% coverage: 2:235/259 of query aligns to 9:242/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
36% identity, 90% coverage: 2:235/259 of query aligns to 9:242/261 of 4izsA
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
30% identity, 91% coverage: 5:239/259 of query aligns to 12:266/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
30% identity, 91% coverage: 5:239/259 of query aligns to 8:262/297 of 5h8jB
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
29% identity, 91% coverage: 5:239/259 of query aligns to 9:263/298 of 5h8lB
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
27% identity, 92% coverage: 2:239/259 of query aligns to 3:241/526 of 5khaA
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
28% identity, 94% coverage: 7:249/259 of query aligns to 11:257/276 of Q9NQR4
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 92% coverage: 2:239/259 of query aligns to 37:285/307 of Q94JV5
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
25% identity, 85% coverage: 20:239/259 of query aligns to 25:275/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
26% identity, 81% coverage: 30:239/259 of query aligns to 34:274/303 of 8hpcC
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
26% identity, 81% coverage: 30:239/259 of query aligns to 34:274/303 of 1uf8A
>SMc01962 FitnessBrowser__Smeli:SMc01962
MMKFAALQMKSIGGDVAANLARIERAAIGASGEGASLLVAPELAITGYGAGEAIRRLAEP
ADGRIVRELGRISLKTGIAIVAGFAEQGADAVYNSAVHVDGDAVPVVYRKSHLYGDYERS
LFTPAEPSTRLFKHRGVTCGMLICYDVEFPENVRRLALAGADAVLVPTALPAGWSGTFIT
DHMIQTRAFENQVFVAYVNHCGSDDMFSFAGLSLIASPDGQALAKAGSSDETLIIAEIDP
QAFAISRAENTYLMDLKHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory