Comparing SMc01967 FitnessBrowser__Smeli:SMc01967 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
48% identity, 86% coverage: 46:347/352 of query aligns to 17:315/318 of Q9I6K2
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
48% identity, 86% coverage: 46:347/352 of query aligns to 15:313/316 of 3nipB
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
48% identity, 86% coverage: 46:347/352 of query aligns to 14:312/315 of 3niqA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
44% identity, 86% coverage: 40:342/352 of query aligns to 11:313/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
44% identity, 86% coverage: 40:342/352 of query aligns to 8:310/316 of 3nioA
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
43% identity, 75% coverage: 78:342/352 of query aligns to 54:315/323 of 4dz4B
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
37% identity, 83% coverage: 46:337/352 of query aligns to 12:304/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
37% identity, 83% coverage: 46:337/352 of query aligns to 4:296/301 of 1gq6B
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
40% identity, 71% coverage: 74:324/352 of query aligns to 37:282/306 of P60651
7lbaB E. Coli agmatinase (see paper)
40% identity, 71% coverage: 74:324/352 of query aligns to 44:289/310 of 7lbaB
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
40% identity, 71% coverage: 74:324/352 of query aligns to 27:272/294 of 7lolA
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
39% identity, 73% coverage: 67:324/352 of query aligns to 3:262/284 of 7loxA
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
34% identity, 89% coverage: 34:345/352 of query aligns to 42:357/378 of 7esrA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
31% identity, 84% coverage: 45:340/352 of query aligns to 6:296/303 of 1wogA
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
31% identity, 77% coverage: 71:342/352 of query aligns to 6:271/276 of 3lhlA
2ef5A Crystal structure of the arginase from thermus thermophilus
33% identity, 78% coverage: 71:344/352 of query aligns to 2:273/273 of 2ef5A
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
33% identity, 76% coverage: 73:338/352 of query aligns to 42:312/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 76% coverage: 73:338/352 of query aligns to 66:336/342 of P46637
Sites not aligning to the query:
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
33% identity, 77% coverage: 73:342/352 of query aligns to 41:315/317 of 6vstA
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
33% identity, 77% coverage: 73:342/352 of query aligns to 44:318/320 of 6vstD
>SMc01967 FitnessBrowser__Smeli:SMc01967
MAWDEQKLNELKAKYGESHGGELFDPTFRKVADKIFTKSGTRLAPYSGIPTFLTAPHMPV
DADDPDFGNLQVAMIGVPMDLGVTNRPGSRFGPRALRAIERIGPYNHVLGCAPVHDLRVA
DIGDVPFRSRYRLEISHEDIEKRISQIVDAGVLPLSVGGDHSITHPILKAVGRKQPVGMI
HIDAHCDTGGAFDLTKFHHGGPFRNAVLDGVLDPTRVIQIGIRGSAEYLWEFSYESGMTV
IHAEEVTGLGIPAIIEKAKKIVGDGPTYLSFDVDSLDPSFAPGTGTPEVGGLTTREVLEL
IRGLKGVNLVGGDVVEVAPQYDTTTNTAHAGAQVLFEILSLMVFSPAVAGKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory