Comparing SMc01978 SMc01978 sugar transport system permease ABC transporter protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
39% identity, 67% coverage: 96:304/311 of query aligns to 291:507/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
39% identity, 66% coverage: 96:299/311 of query aligns to 276:489/490 of 4ki0F
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
29% identity, 83% coverage: 32:289/311 of query aligns to 15:264/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
30% identity, 85% coverage: 22:286/311 of query aligns to 27:288/313 of P94529
>SMc01978 SMc01978 sugar transport system permease ABC transporter protein
MAYAARHDGLPATRPPLMKRIADASAPYLYTAPALILIVTVMLVPLVLGISYAFRDIQLL
NPFSGGFVGLDHFRALAQDQAFFRSLRNTLWWTGASVFLQFAFGLILALLLDKPFHGRAI
AQALVFLPWAVPSFLAGLNWAWLFNPVVGPLPHWLFALGIMSQPTNILSDPQLAMWGPIV
ANIWWGIPFFAITLLAALQAIPRDLYEAASIDGAGPLQRFLSITLPFLAPTIAITILLRT
VWISNFADLIIVMTNGGPADRTQIVASYIFTQAFKRLDFGYASAIALVLLALLLAYSLLI
VILRQWLLSKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory