Comparing SMc01993 FitnessBrowser__Smeli:SMc01993 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
39% identity, 94% coverage: 6:107/109 of query aligns to 4:104/104 of P0A185
Sites not aligning to the query:
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
39% identity, 94% coverage: 6:107/109 of query aligns to 3:103/103 of 2qpzA
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
40% identity, 94% coverage: 5:107/109 of query aligns to 1:102/102 of 5bokA
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
36% identity, 97% coverage: 4:109/109 of query aligns to 2:107/107 of Q8GI16
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
36% identity, 97% coverage: 4:109/109 of query aligns to 1:106/114 of 4nbbE
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
37% identity, 94% coverage: 6:107/109 of query aligns to 2:103/109 of 1fqtA
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
37% identity, 92% coverage: 6:105/109 of query aligns to 1:100/102 of 2i7fA
2e4pA Crystal structure of bpha3 (oxidized form) (see paper)
33% identity, 93% coverage: 6:106/109 of query aligns to 1:101/108 of 2e4pA
3dqyA Crystal structure of toluene 2,3-dioxygenase ferredoxin (see paper)
35% identity, 75% coverage: 26:107/109 of query aligns to 20:101/106 of 3dqyA
3gkeB Crystal structure of dicamba monooxygenase (see paper)
34% identity, 68% coverage: 31:104/109 of query aligns to 31:110/334 of 3gkeB
Sites not aligning to the query:
3gobA Crystal structure of dicamba monooxygenase with non-heme cobalt and dcsa (see paper)
34% identity, 68% coverage: 31:104/109 of query aligns to 32:111/342 of 3gobA
Sites not aligning to the query:
3gb4A Crystal structure of dicamba monooxygenase with non-heme cobalt and dicamba (see paper)
34% identity, 68% coverage: 31:104/109 of query aligns to 31:110/341 of 3gb4A
Sites not aligning to the query:
3gkeA Crystal structure of dicamba monooxygenase (see paper)
34% identity, 68% coverage: 31:104/109 of query aligns to 31:110/340 of 3gkeA
Sites not aligning to the query:
Q5S3I3 Dicamba O-demethylase, oxygenase component; Dicamba monooxygenase; DMO; Three-component Rieske non-heme iron oxygenase system; EC 1.14.15.- from Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia) (see 3 papers)
34% identity, 68% coverage: 31:104/109 of query aligns to 31:110/339 of Q5S3I3
Sites not aligning to the query:
6vshC Crystal structure of apo dicamba monooxygenase (see paper)
34% identity, 68% coverage: 31:104/109 of query aligns to 31:110/320 of 6vshC
3gceA Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 (see paper)
35% identity, 71% coverage: 24:100/109 of query aligns to 20:96/104 of 3gceA
7qwtA Rieske non-heme iron monooxygenase for guaiacol o-demethylation
30% identity, 95% coverage: 5:108/109 of query aligns to 9:118/352 of 7qwtA
Sites not aligning to the query:
>SMc01993 FitnessBrowser__Smeli:SMc01993
MLDDRNWVKACDAKKVGREDVARWDHSGRSFAIFRTADDQYYATDDICTHEYAHISDGFV
EGTTVECPRHAGCFDFRTGEALNPPVCVNLRTFPVKVVDGAVYIDIDER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory