SitesBLAST
Comparing SMc02016 FitnessBrowser__Smeli:SMc02016 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
40% identity, 96% coverage: 13:417/420 of query aligns to 6:401/402 of 2yvjA
- active site: L13 (≠ H20), R44 (= R51), P45 (= P52), Q291 (≠ E305)
- binding flavin-adenine dinucleotide: G10 (= G17), G12 (= G19), G35 (≠ D42), D36 (≠ G43), E37 (= E44), R44 (= R51), P45 (= P52), A78 (= A89), T105 (= T116), G106 (= G117), R126 (= R137), G268 (= G283), D269 (= D284), T286 (≠ C300), W287 (= W301), A290 (= A304), W316 (= W329)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V158), G148 (= G159), G149 (= G160), G150 (= G161), I152 (= I163), V170 (= V181), E171 (= E182), T172 (≠ A183), R179 (= R190), G230 (≠ S245), I231 (≠ V246), G232 (= G247), V233 (= V248), E285 (= E299)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
40% identity, 96% coverage: 13:417/420 of query aligns to 7:402/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G19), A15 (= A21), D37 (≠ G43), E38 (= E44), R45 (= R51), P46 (= P52), K50 (= K56), A79 (= A89), T106 (= T116), G107 (= G117), R127 (= R137), I153 (= I163), G269 (= G283), D270 (= D284), E286 (= E299), T287 (≠ C300), W288 (= W301), A291 (= A304), W317 (= W329)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
40% identity, 96% coverage: 13:417/420 of query aligns to 5:400/401 of 2gr2A
- active site: L12 (≠ H20), R43 (= R51), P44 (= P52), Q290 (≠ E305)
- binding adenosine-5-diphosphoribose: R109 (= R121), V146 (= V158), G147 (= G159), G149 (= G161), V150 (≠ L162), I151 (= I163), E170 (= E182), T171 (≠ A183), R178 (= R190), G229 (≠ S245), I230 (≠ V246), G231 (= G247), E284 (= E299)
- binding flavin-adenine dinucleotide: G11 (= G19), A13 (= A21), D35 (≠ G43), E36 (= E44), R43 (= R51), P44 (= P52), K48 (= K56), A77 (= A89), T104 (= T116), G105 (= G117), R125 (= R137), G267 (= G283), D268 (= D284), T285 (≠ C300), W286 (= W301), A289 (= A304), W315 (= W329)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
40% identity, 96% coverage: 13:417/420 of query aligns to 5:400/401 of 2gr0A
- active site: L12 (≠ H20), R43 (= R51), P44 (= P52), Q290 (≠ E305)
- binding adenosine-5'-diphosphate: V146 (= V158), G147 (= G159), G149 (= G161), I151 (= I163), E170 (= E182), T171 (≠ A183), R178 (= R190), G229 (≠ S245), I230 (≠ V246), G231 (= G247)
- binding flavin-adenine dinucleotide: G11 (= G19), A13 (= A21), D35 (≠ G43), E36 (= E44), R43 (= R51), P44 (= P52), K48 (= K56), T76 (≠ A88), A77 (= A89), T104 (= T116), G105 (= G117), R125 (= R137), I151 (= I163), G267 (= G283), D268 (= D284), E284 (= E299), T285 (≠ C300), W286 (= W301), A289 (= A304), W315 (= W329)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
40% identity, 96% coverage: 13:417/420 of query aligns to 6:401/401 of 1f3pA
- active site: L13 (≠ H20), R44 (= R51), P45 (= P52), Q291 (≠ E305)
- binding flavin-adenine dinucleotide: A14 (= A21), V34 (= V41), D36 (≠ G43), E37 (= E44), R44 (= R51), P45 (= P52), A78 (= A89), T105 (= T116), G106 (= G117), R126 (= R137), G268 (= G283), D269 (= D284), E285 (= E299), T286 (≠ C300), W287 (= W301), A290 (= A304), W316 (= W329)
- binding nicotinamide-adenine-dinucleotide: V147 (= V158), G148 (= G159), G150 (= G161), V151 (≠ L162), I152 (= I163), E155 (= E166), E171 (= E182), T172 (≠ A183), R179 (= R190), G230 (≠ S245), I231 (≠ V246), G232 (= G247), V233 (= V248), E285 (= E299), W316 (= W329), S317 (= S330)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
40% identity, 96% coverage: 13:417/420 of query aligns to 6:401/401 of 4h4uA
- active site: L13 (≠ H20), R44 (= R51), P45 (= P52), Q291 (≠ E305)
- binding flavin-adenine dinucleotide: G12 (= G19), A14 (= A21), D36 (≠ G43), R44 (= R51), P45 (= P52), A78 (= A89), T105 (= T116), G106 (= G117), L125 (= L136), R126 (= R137), I152 (= I163), E155 (= E166), G268 (= G283), D269 (= D284), E285 (= E299), T286 (≠ C300), W287 (= W301), A290 (= A304), W316 (= W329)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ L162), I152 (= I163), E171 (= E182), R172 (≠ A183), Q173 (≠ G184), G230 (≠ S245), I231 (≠ V246), G232 (= G247), I284 (≠ L298), E285 (= E299), Y315 (≠ M328)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
40% identity, 96% coverage: 13:415/420 of query aligns to 5:398/399 of 4h4wA
- active site: L12 (≠ H20), R43 (= R51), P44 (= P52), Q290 (≠ E305)
- binding flavin-adenine dinucleotide: G11 (= G19), A13 (= A21), D35 (≠ G43), R43 (= R51), P44 (= P52), A77 (= A89), T104 (= T116), G105 (= G117), R125 (= R137), I151 (= I163), E154 (= E166), G267 (= G283), D268 (= D284), T285 (≠ C300), W286 (= W301), A289 (= A304), W315 (= W329)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (= G160), I151 (= I163), R171 (≠ A183), S177 (≠ M189), R178 (= R190), G229 (≠ S245), I230 (≠ V246), G231 (= G247)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
37% identity, 97% coverage: 10:415/420 of query aligns to 1:403/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G17), G10 (= G19), H11 (= H20), A12 (= A21), D34 (≠ G43), E35 (= E44), R42 (= R51), P43 (= P52), S46 (= S55), K47 (= K56), R78 (≠ A88), M79 (≠ A89), T106 (= T116), R127 (= R137), I153 (= I163), D275 (= D284), S292 (≠ C300), V293 (≠ W301), W321 (= W329)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
36% identity, 90% coverage: 12:388/420 of query aligns to 5:385/409 of 3lxdA
- active site: H13 (= H20), R44 (= R51), P45 (= P52), N302 (≠ E305)
- binding flavin-adenine dinucleotide: V9 (= V16), G10 (= G17), G12 (= G19), H13 (= H20), G14 (≠ A21), R36 (≠ G43), E37 (= E44), R44 (= R51), P45 (= P52), S48 (= S55), K49 (= K56), E81 (≠ A88), V82 (≠ A89), T109 (= T116), I157 (= I163), G278 (= G283), D279 (= D284), S297 (≠ C300), V298 (≠ W301), F325 (≠ M328), W326 (= W329)
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
35% identity, 91% coverage: 10:390/420 of query aligns to 3:384/422 of 1q1wA
- active site: L13 (≠ H20), L44 (≠ R51), P45 (= P52), L305 (≠ E305)
- binding flavin-adenine dinucleotide: G10 (= G17), G12 (= G19), L13 (≠ H20), A14 (= A21), G35 (≠ D42), D36 (≠ G43), L44 (≠ R51), P45 (= P52), K49 (= K56), V82 (≠ A89), A108 (= A115), T109 (= T116), G110 (= G117), R133 (= R137), I159 (= I163), D283 (= D284), S300 (≠ C300), V301 (≠ W301), W329 (= W329)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
35% identity, 91% coverage: 10:390/420 of query aligns to 4:385/422 of P16640
- A15 (= A21) binding
- D37 (≠ G43) binding
- K50 (= K56) binding
- V83 (≠ A89) binding
- R134 (= R137) binding
- D284 (= D284) binding
- V302 (≠ W301) binding
6tukB Crystal structure of fdr9 (see paper)
33% identity, 95% coverage: 11:411/420 of query aligns to 2:390/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (= V16), G8 (= G17), G9 (≠ C18), G10 (= G19), A12 (= A21), A34 (≠ G43), E35 (= E44), R42 (= R51), P43 (= P52), K47 (= K56), A75 (= A88), A76 (= A89), T102 (= T116), G103 (= G117), V118 (≠ L136), R119 (= R137), G259 (= G283), D260 (= D284), H277 (≠ C300), W278 (= W301), F311 (≠ M328), W312 (= W329)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 97% coverage: 12:417/420 of query aligns to 4:404/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G19), V12 (≠ H20), G13 (≠ A21), D35 (≠ G43), E36 (= E44), R43 (= R51), P44 (= P52), S47 (= S55), K48 (= K56), V80 (≠ A89), T107 (= T116), G108 (= G117), R128 (= R137), G274 (= G283), D275 (= D284), T291 (≠ C300), Y292 (≠ W301), S319 (≠ M328), W320 (= W329)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 96% coverage: 12:416/420 of query aligns to 3:402/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G19), V11 (≠ H20), G12 (≠ A21), D34 (≠ G43), E35 (= E44), R42 (= R51), P43 (= P52), K47 (= K56), E78 (≠ A88), V79 (≠ A89), T106 (= T116), G107 (= G117), G273 (= G283), D274 (= D284), T290 (≠ C300), Y291 (≠ W301), W319 (= W329)
- binding nicotinamide-adenine-dinucleotide: R111 (= R121), G149 (= G159), L152 (= L162), I153 (= I163), E156 (= E166), E172 (= E182), A173 (= A183), R180 (= R190), V236 (= V246), G237 (= G247), A238 (≠ V248), E289 (= E299), W319 (= W329), T320 (≠ S330)
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
33% identity, 73% coverage: 14:319/420 of query aligns to 4:312/424 of 8c0zE
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 74% coverage: 36:345/420 of query aligns to 31:360/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
5jclA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 74% coverage: 36:345/420 of query aligns to 30:362/429 of 5jclA
- active site: R45 (= R51), P46 (= P52), L61 (≠ A68), H65 (≠ P72), S70 (vs. gap), R317 (≠ E305)
- binding flavin-adenine dinucleotide: S36 (≠ D42), K37 (≠ G43), E38 (= E44), R45 (= R51), P46 (= P52), K50 (= K56), I93 (≠ A89), A119 (= A115), T120 (= T116), G121 (= G117), R144 (= R137), E145 (≠ S138), D295 (= D284), E311 (= E299), H312 (≠ C300), V313 (≠ W301), A316 (= A304), Y346 (≠ W329)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G170 (= G161), Y171 (≠ L162), I172 (= I163), E175 (= E166), P192 (≠ A183), R199 (= R190), G256 (≠ S245), V257 (= V246), G258 (= G247), E311 (= E299), H312 (≠ C300), Y346 (≠ W329)
Sites not aligning to the query:
Q652L6 Monodehydroascorbate reductase 3, cytosolic; OsMDAR3; OsMDHAR3; EC 1.6.5.4 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 74% coverage: 36:345/420 of query aligns to 33:365/435 of Q652L6
- E41 (= E44) binding
- R48 (= R51) binding
- K53 (= K56) binding
- C70 (vs. gap) mutation to A: No effect on catalytic activity.; mutation to S: Slight reduction of catalytic activity.
- G72 (vs. gap) mutation to N: Slight reduction of catalytic activity.
- I96 (≠ A89) binding
- RE 147:148 (≠ RS 137:138) binding
- 172:178 (vs. 160:166, 86% identical) binding
- YIGLE 174:178 (≠ LIGLE 162:166) binding
- E196 (≠ G184) binding ; mutation to A: Reduces catalytic activity 2-fold.
- R202 (= R190) binding ; binding
- G261 (= G247) binding ; binding
- D298 (= D284) binding
- EH 314:315 (≠ EC 299:300) binding ; binding
- V316 (≠ W301) binding
- R320 (≠ E305) binding ; mutation to A: Reduces catalytic activity 5-fold.
- Y349 (≠ W329) binding ; binding ; binding ; mutation Y->A,F,W: Abolishes catalytic activity.
- R351 (≠ D331) binding ; mutation to A: No effect on catalytic activity.
Sites not aligning to the query:
5jciA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 74% coverage: 36:345/420 of query aligns to 30:362/432 of 5jciA
- active site: R45 (= R51), P46 (= P52), L61 (≠ A68), H65 (≠ P72), S70 (vs. gap), R317 (≠ E305)
- binding flavin-adenine dinucleotide: S36 (≠ D42), K37 (≠ G43), E38 (= E44), R45 (= R51), P46 (= P52), K50 (= K56), I93 (≠ A89), A119 (= A115), T120 (= T116), G121 (= G117), R144 (= R137), E145 (≠ S138), Y171 (≠ L162), I172 (= I163), L262 (≠ R251), D295 (= D284), H312 (≠ C300), V313 (≠ W301), A316 (= A304), F345 (≠ M328), Y346 (≠ W329)
Sites not aligning to the query:
5jcnA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 74% coverage: 36:345/420 of query aligns to 30:362/429 of 5jcnA
- active site: R45 (= R51), P46 (= P52), L61 (≠ A68), H65 (≠ P72), S70 (vs. gap), R317 (≠ E305)
- binding ascorbic acid: P46 (= P52), G69 (vs. gap), R317 (≠ E305), F346 (≠ W329)
- binding flavin-adenine dinucleotide: K37 (≠ G43), E38 (= E44), R45 (= R51), P46 (= P52), K50 (= K56), I93 (≠ A89), A119 (= A115), T120 (= T116), R144 (= R137), E145 (≠ S138), L262 (≠ R251), D295 (= D284), E311 (= E299), H312 (≠ C300), V313 (≠ W301), F346 (≠ W329)
- binding nicotinamide-adenine-dinucleotide: G170 (= G161), Y171 (≠ L162), I172 (= I163), P192 (≠ A183), G256 (≠ S245), V257 (= V246), G258 (= G247), E311 (= E299), H312 (≠ C300), F346 (≠ W329)
Sites not aligning to the query:
Query Sequence
>SMc02016 FitnessBrowser__Smeli:SMc02016
MRPRRGPVHQENMVIVGCGHAGARAAQALRTNGWHGGITLVDGEGRTPYERPPLSKAVLK
GESEAEDAPLFPADFLAKNDIHVLKGVAAAAIDRPTRQLRLSDGGSIAYHRLLLATGAEP
RNLIVPGADLPGSHTLRSADDAARIFPYLRPGAEIVIVGGGLIGLEAAASATVRGCKVTV
VEAGPRPMMRAVPAELSHEVRLFHESKDVRFVLGRQVSELEGDGRVRCVRLDDGTVLPCT
AVVISVGVSPRTALAEAAGLEIDNGIAVDRFLRTSDPFIYAAGDACAFEQVSGPRMRLEC
WKNAEDQGTLAGRNMLGSDEAYVPLPWMWSDQFDRTMQIAGQAGGSAEDVRRRCPDSTLL
IYHLDKDQMILGISGFGSIREVSRGVRMGQLLMERGIRPGRKALADPEFDLRSLAKAAVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory