Comparing SMc02033 FitnessBrowser__Smeli:SMc02033 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
26% identity, 80% coverage: 39:355/395 of query aligns to 2:258/274 of 2ioyA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
23% identity, 71% coverage: 45:326/395 of query aligns to 3:240/287 of 5dteB
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
25% identity, 72% coverage: 87:371/395 of query aligns to 50:286/287 of 4yo7A
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
28% identity, 75% coverage: 50:347/395 of query aligns to 7:262/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
28% identity, 75% coverage: 50:347/395 of query aligns to 7:262/288 of 1gudA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
28% identity, 76% coverage: 50:349/395 of query aligns to 7:264/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
28% identity, 76% coverage: 50:349/395 of query aligns to 7:264/288 of 8wl9A
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
28% identity, 61% coverage: 83:324/395 of query aligns to 46:237/289 of 5hqjA
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
24% identity, 78% coverage: 61:367/395 of query aligns to 24:270/270 of 4zjpA
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
29% identity, 23% coverage: 77:168/395 of query aligns to 37:129/290 of 4wutA
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
24% identity, 58% coverage: 55:283/395 of query aligns to 16:203/302 of 5ocpA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
24% identity, 61% coverage: 87:326/395 of query aligns to 45:239/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
24% identity, 61% coverage: 87:326/395 of query aligns to 45:239/304 of 6hbmA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
25% identity, 70% coverage: 59:334/395 of query aligns to 21:245/292 of 2fn8A
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
24% identity, 61% coverage: 87:326/395 of query aligns to 46:240/305 of 6hbdA
Sites not aligning to the query:
3ma0A Closed liganded crystal structure of xylose binding protein from escherichia coli (see paper)
25% identity, 68% coverage: 88:356/395 of query aligns to 47:265/313 of 3ma0A
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
22% identity, 78% coverage: 49:356/395 of query aligns to 12:265/284 of 7e7mC
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
34% identity, 22% coverage: 88:173/395 of query aligns to 46:131/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
34% identity, 22% coverage: 88:173/395 of query aligns to 46:131/313 of 2h3hA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
23% identity, 71% coverage: 45:324/395 of query aligns to 10:233/288 of 4rxmB
Sites not aligning to the query:
>SMc02033 FitnessBrowser__Smeli:SMc02033
MFKKLAKSSLFAAAATIAVLPMLGAVPAVAQDGENIDVTIGWVPPDITGVFKTATNFFEL
AAEDANKNGFNVKVLTKSPTSPTAFAEQVSIIEDMIQRKVDLIAVSPAEVATIKPALARA
TAAGIPVVVVNLLEPIDGVDVSSYIGFDNTQGAEVSAYSVVDYFGGPGVLGTGDKVDVEP
GTYLDLKFWEDIASKLSAEDKAKIKARGAIIEGVAGGFYSTARLEGFRKVLEQFPGIEIV
GGTCAGDWNREKGTRCAEDILQANQGNLDFIWAASNEMGLGAMLVAGSQNRLETTQDGAA
VGDTKVAIFTNDVTPESVDRIAEGKMIAETTHGFADWGWFGTKFAVELACGLEVPKTFDI
RPRSVYEANARNFYPEPKLEPIDWKTIRANCKKAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory