SitesBLAST
Comparing SMc02034 FitnessBrowser__Smeli:SMc02034 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
47% identity, 100% coverage: 2:257/257 of query aligns to 3:254/254 of 3lqfA
- active site: G22 (= G21), S144 (= S147), Y159 (= Y162), K163 (= K166)
- binding meso-erythritol: N151 (= N154), Y159 (= Y162), Y191 (= Y194), T197 (≠ L200), M200 (≠ A203)
- binding nicotinamide-adenine-dinucleotide: G18 (= G17), S21 (≠ Q20), G22 (= G21), I23 (= I22), D42 (= D41), R43 (≠ I42), D66 (= D67), V67 (≠ I68), S92 (≠ N94), L142 (≠ I145), S144 (= S147), K163 (= K166), P189 (= P192), V192 (≠ I195), T194 (= T197), M196 (≠ L199), T197 (≠ L200)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
47% identity, 100% coverage: 2:257/257 of query aligns to 3:254/254 of 2wsbA
- active site: G22 (= G21), S144 (= S147), Y159 (= Y162), K163 (= K166)
- binding nicotinamide-adenine-dinucleotide: G18 (= G17), S21 (≠ Q20), G22 (= G21), I23 (= I22), D42 (= D41), R43 (≠ I42), D66 (= D67), V67 (≠ I68), S92 (≠ N94), A93 (= A95), L142 (≠ I145), S144 (= S147), Y159 (= Y162), K163 (= K166), P189 (= P192), V192 (≠ I195), T194 (= T197), M196 (≠ L199), T197 (≠ L200)
- binding n-propanol: S144 (= S147), M145 (= M148), N151 (= N154), N151 (= N154), Y159 (= Y162), Y159 (= Y162), Y191 (= Y194)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
47% identity, 100% coverage: 2:257/257 of query aligns to 3:254/254 of 2wdzA
- active site: G22 (= G21), S144 (= S147), Y159 (= Y162), K163 (= K166)
- binding (2S)-pentane-1,2-diol: A45 (= A44), D49 (≠ E48), R62 (≠ T63), S146 (= S149), Y159 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G18 (= G17), S21 (≠ Q20), G22 (= G21), I23 (= I22), D42 (= D41), R43 (≠ I42), A65 (≠ I66), D66 (= D67), V67 (≠ I68), S92 (≠ N94), A93 (= A95), L142 (≠ I145), S144 (= S147), Y159 (= Y162), K163 (= K166), P189 (= P192), V192 (≠ I195), T194 (= T197), M196 (≠ L199), T197 (≠ L200)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
47% identity, 100% coverage: 2:257/257 of query aligns to 3:254/254 of C0KTJ6
7vyqA Short chain dehydrogenase (scr) cryoem structure with NADP and ethyl 4-chloroacetoacetate (see paper)
38% identity, 99% coverage: 3:256/257 of query aligns to 28:279/280 of 7vyqA
- binding ethyl 4-chloranyl-3-oxidanylidene-butanoate: T123 (≠ A98), S173 (= S147), Q183 (= Q157), Y219 (= Y194), F227 (= F202), W236 (= W213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G42 (= G17), S44 (≠ G19), G45 (≠ Q20), G46 (= G21), I47 (= I22), N67 (≠ I42), H69 (≠ A44), I93 (= I68), N119 (= N94), A120 (= A95), G121 (= G96), V144 (≠ I118), S173 (= S147), Y188 (= Y162), K192 (= K166), P217 (= P192), G218 (≠ T193), I220 (= I195), T222 (= T197), I224 (≠ L199), T225 (≠ L200)
7dlmA Short chain dehydrogenase (scr) crystal structure with NADPH (see paper)
38% identity, 99% coverage: 3:256/257 of query aligns to 28:279/280 of 7dlmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G42 (= G17), S44 (≠ G19), G45 (≠ Q20), G46 (= G21), I47 (= I22), Y66 (≠ D41), N67 (≠ I42), S68 (= S43), H69 (≠ A44), C91 (≠ I66), N92 (≠ D67), I93 (= I68), N119 (= N94), A120 (= A95), G121 (= G96), V122 (≠ I97), T171 (≠ I145), S173 (= S147), Y188 (= Y162), K192 (= K166), P217 (= P192), G218 (≠ T193), I220 (= I195), T222 (= T197), I224 (≠ L199)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 97% coverage: 6:255/257 of query aligns to 3:253/255 of 5itvA
- active site: G18 (= G21), S141 (= S147), Y154 (= Y162), K158 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G17), S17 (≠ Q20), G18 (= G21), I19 (= I22), D38 (= D41), I39 (= I42), T61 (= T63), I63 (≠ L65), N89 (= N94), G91 (= G96), T139 (≠ I145), S141 (= S147), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (≠ T193), I186 (≠ Y194), I187 (= I195)
7dn1B Hetero-oligomers of scr-scr2 crystal structure with NADPH (see paper)
40% identity, 99% coverage: 3:256/257 of query aligns to 28:279/280 of 7dn1B
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G42 (= G17), S44 (≠ G19), G45 (≠ Q20), G46 (= G21), I47 (= I22), N67 (≠ I42), S68 (= S43), H69 (≠ A44), N92 (≠ D67), I93 (= I68), N119 (= N94), A120 (= A95), G121 (= G96), L144 (≠ I118), T171 (≠ I145), S173 (= S147), Y188 (= Y162), K192 (= K166), P217 (= P192), G218 (≠ T193), I220 (= I195), T222 (= T197)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
37% identity, 98% coverage: 3:255/257 of query aligns to 9:258/261 of 5u9pB
- active site: G27 (= G21), S152 (= S147), Y165 (= Y162), K169 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G17), R26 (≠ Q20), G27 (= G21), I28 (= I22), R48 (≠ I42), D73 (= D67), V74 (≠ I68), N100 (= N94), A101 (= A95), I150 (= I145), Y165 (= Y162), K169 (= K166), P195 (= P192), F198 (≠ I195), T200 (= T197), L202 (= L200), N203 (≠ T201)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 96% coverage: 8:254/257 of query aligns to 3:245/248 of 4urfB
- active site: G16 (= G21), S142 (= S147), I152 (≠ Q159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M219), R211 (≠ H220), R212 (= R221)
- binding bicarbonate ion: I92 (= I97), G94 (≠ H99), R109 (= R114), R179 (= R186), S228 (= S237)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), G14 (= G19), N15 (≠ Q20), G16 (= G21), I17 (= I22), D36 (= D41), I37 (= I42), D62 (= D70), T63 (≠ S71), N89 (= N94), A90 (= A95), G91 (= G96), I140 (= I145), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ T193), I188 (= I195), T190 (= T197)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 96% coverage: 8:254/257 of query aligns to 3:245/248 of 4urfA
- active site: G16 (= G21), S142 (= S147), I152 (≠ Q159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I97), S93 (≠ A98), G94 (≠ H99), E95 (≠ A100), T97 (≠ V102), E101 (= E106), T103 (≠ S108), Q106 (≠ D111), R109 (= R114), S175 (≠ A182), G177 (= G184)
- binding magnesium ion: S237 (= S246), Y238 (≠ I247)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), G14 (= G19), N15 (≠ Q20), G16 (= G21), I17 (= I22), D36 (= D41), I37 (= I42), W41 (≠ R46), D62 (= D70), T63 (≠ S71), N89 (= N94), A90 (= A95), G91 (= G96), I140 (= I145), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (= I195), T190 (= T197)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 96% coverage: 8:254/257 of query aligns to 3:245/248 of 4ureB
- active site: G16 (= G21), S142 (= S147), I152 (≠ Q159), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ Q20), G16 (= G21), I17 (= I22), N89 (= N94), G91 (= G96), Y155 (= Y162), P185 (= P192), A186 (≠ T193)
7dmgA Short chain dehydrogenase 2 (scr2) crystal structure with NADP (see paper)
40% identity, 99% coverage: 3:256/257 of query aligns to 28:275/276 of 7dmgA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G42 (= G17), S44 (≠ G19), G45 (≠ Q20), G46 (= G21), I47 (= I22), N67 (≠ I42), S68 (= S43), H69 (≠ A44), C91 (≠ I66), N92 (≠ D67), I93 (= I68), N119 (= N94), A120 (= A95), G121 (= G96), V122 (≠ I97), L144 (≠ I118), T171 (≠ I145), S173 (= S147), Y188 (= Y162), K192 (= K166), P217 (= P192), G218 (≠ T193)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
38% identity, 96% coverage: 8:255/257 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G21), S142 (= S147), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), S15 (≠ Q20), G16 (= G21), I17 (= I22), D36 (= D41), I37 (= I42), A61 (≠ I66), D62 (= D67), T63 (≠ I68), N89 (= N94), A90 (= A95), M140 (≠ I145), S142 (= S147), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ T193), Y187 (= Y194), I188 (= I195), L192 (= L199)
5jlaD Crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
40% identity, 96% coverage: 7:254/257 of query aligns to 4:244/259 of 5jlaD
- active site: G18 (= G21), S139 (= S147), L148 (≠ Q159), Y151 (= Y162), K155 (= K166), H196 (≠ K207)
- binding nicotinamide-adenine-dinucleotide: G14 (= G17), S17 (≠ Q20), G18 (= G21), I19 (= I22), D38 (= D41), R39 (≠ I42), L58 (≠ I66), D59 (= D67), V60 (≠ I68), C86 (≠ N94), A87 (= A95), I137 (= I145), S139 (= S147), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (≠ T193), F183 (≠ Y194), T184 (≠ I195), T186 (= T197), A188 (≠ L199)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
38% identity, 97% coverage: 8:256/257 of query aligns to 2:239/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), M16 (≠ I22), D35 (= D41), I36 (= I42), I62 (= I68), N88 (= N94), G90 (= G96), I138 (= I145), S140 (= S147), Y152 (= Y162), K156 (= K166), I185 (= I195)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
38% identity, 97% coverage: 8:256/257 of query aligns to 3:240/248 of Q9KJF1
- S15 (≠ Q20) binding
- D36 (= D41) binding
- D62 (= D67) binding
- I63 (= I68) binding
- N89 (= N94) binding
- Y153 (= Y162) binding
- K157 (= K166) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7krgF Crystal structure of mannitol dehydrogenase (chmdh) from cladosporium herbarum in complex with NADP+ and na (see paper)
38% identity, 98% coverage: 3:255/257 of query aligns to 16:268/270 of 7krgF
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G30 (= G17), S32 (≠ G19), G36 (= G21), M37 (≠ I22), A57 (≠ I42), S58 (= S43), R59 (vs. gap), Q84 (≠ E62), V85 (≠ T63), N111 (= N94), A112 (= A95), G113 (= G96), T161 (≠ I145), S163 (= S147), Y178 (= Y162), K182 (= K166), G208 (≠ T193), I210 (= I195), T212 (= T197), L214 (= L199)
3gdfA Crystal structure of the NADP-dependent mannitol dehydrogenase from cladosporium herbarum. (see paper)
38% identity, 98% coverage: 3:255/257 of query aligns to 13:265/267 of 3gdfA
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
40% identity, 96% coverage: 6:253/257 of query aligns to 1:240/244 of 6t77A
- active site: G16 (= G21), S138 (= S147), Y151 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ G19), R15 (≠ Q20), T37 (≠ I42), L58 (≠ I66), N59 (≠ D67), V60 (≠ I68), A87 (= A95), G88 (= G96), I89 (= I97)
Query Sequence
>SMc02034 FitnessBrowser__Smeli:SMc02034
MYLRKFDLSGRVAVVTGAGQGIGLACAEALCEAGAAVVLTDISAERCEAGRAALAAKGYV
VETDLIDIGDSASVNAVADRLAVSGRAADILVANAGIAHAGVPAEELSDADWERMIGINL
SGAFRSCRAFGRHMLAKGRGSIVTIGSMSGTIVNRPQQQVHYNAAKAGVHHLTRSLAAEW
AARGVRVNSVAPTYIDTPLLTFAKEDKPMYEQWLDMTPMHRLGQPDEIASVVLFLASDAS
SLMTGSIVAADAGYTCW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory