Comparing SMc02038 FitnessBrowser__Smeli:SMc02038 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uhjA Crystal structure of a probable glycerol dehydrogenase from sinorhizobium meliloti 1021
98% identity, 100% coverage: 1:363/364 of query aligns to 1:357/357 of 3uhjA
8gobA Crystal structure of glycerol dehydrogenase in the presence of NAD+ (see paper)
48% identity, 99% coverage: 1:361/364 of query aligns to 1:360/367 of 8gobA
8goaA Crystal structure of glycerol dehydrogenase in the absence of NAD+ (see paper)
48% identity, 99% coverage: 1:361/364 of query aligns to 1:360/367 of 8goaA
5zxlA Structure of glda from e.Coli (see paper)
48% identity, 99% coverage: 1:361/364 of query aligns to 1:360/367 of 5zxlA
P0A9S5 Glycerol dehydrogenase; GDH; GLDH; (R)-aminopropanol dehydrogenase; 1,2-propanediol dehydrogenase; D-1-amino-2-propanol oxidoreductase; EC 1.1.1.6; EC 1.1.1.75 from Escherichia coli (strain K12) (see paper)
48% identity, 99% coverage: 1:361/364 of query aligns to 1:360/367 of P0A9S5
4mcaA Crystal structure of glycerol dehydrogenase from serratia to 1.9a
47% identity, 98% coverage: 1:357/364 of query aligns to 1:356/367 of 4mcaA
1kq3A Crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution (see paper)
48% identity, 97% coverage: 8:361/364 of query aligns to 9:359/364 of 1kq3A
Q9WYQ4 Glycerol dehydrogenase; GDH; GLDH; EC 1.1.1.6 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
48% identity, 97% coverage: 8:361/364 of query aligns to 8:358/364 of Q9WYQ4
5xn8A Structure of glycerol dehydrogenase crystallised as a contaminant
45% identity, 99% coverage: 1:362/364 of query aligns to 1:361/365 of 5xn8A
P32816 Glycerol dehydrogenase; GDH; GLDH; GlyDH; EC 1.1.1.6 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
44% identity, 99% coverage: 3:362/364 of query aligns to 5:363/370 of P32816
1jq5A Bacillus stearothermophilus glycerol dehydrogenase complex with NAD+ (see paper)
44% identity, 99% coverage: 3:362/364 of query aligns to 4:362/366 of 1jq5A
1jqaA Bacillus stearothermophilus glycerol dehydrogenase complex with glycerol (see paper)
44% identity, 99% coverage: 3:362/364 of query aligns to 3:357/361 of 1jqaA
1ta9B Crystal structure of glycerol dehydrogenase from schizosaccharomyces pombe
38% identity, 99% coverage: 3:361/364 of query aligns to 8:366/394 of 1ta9B
O13702 Glycerol dehydrogenase 1; GDH; GLDH; EC 1.1.1.6 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
38% identity, 99% coverage: 3:361/364 of query aligns to 64:422/450 of O13702
Q9YER2 Glycerol-1-phosphate dehydrogenase [NAD(P)+]; G1P dehydrogenase; G1PDH; Gro1PDH; Enantiomeric glycerophosphate synthase; sn-glycerol-1-phosphate dehydrogenase; EC 1.1.1.261 from Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) (see paper)
24% identity, 85% coverage: 8:318/364 of query aligns to 11:312/352 of Q9YER2
5fb3F Structure of glycerophosphate dehydrogenase in complex with NADPH (see paper)
25% identity, 87% coverage: 5:319/364 of query aligns to 6:299/337 of 5fb3F
4rgqB Crystal structure of the methanocaldococcus jannaschii g1pdh with NADPH and dhap (see paper)
24% identity, 65% coverage: 85:319/364 of query aligns to 68:296/333 of 4rgqB
Sites not aligning to the query:
4rgvA Crystal structure of the methanocaldococcus jannaschii g1pdh (see paper)
24% identity, 65% coverage: 85:319/364 of query aligns to 65:291/328 of 4rgvA
3ce9A Crystal structure of glycerol dehydrogenase (np_348253.1) from clostridium acetobutylicum at 2.37 a resolution
30% identity, 29% coverage: 85:189/364 of query aligns to 85:192/349 of 3ce9A
Sites not aligning to the query:
P31005 NAD-dependent methanol dehydrogenase; MDH; MEDH; Type 3 alcohol dehydrogenase; EC 1.1.1.244 from Bacillus methanolicus (see 3 papers)
25% identity, 87% coverage: 1:318/364 of query aligns to 1:346/381 of P31005
>SMc02038 FitnessBrowser__Smeli:SMc02038
MARAFGGPNKYIQRAGEIDKLAAYLAPLGKRALVLIDRVLFDALSERIGKSCGDSLDIRF
ERFGGECCTSEIERVRKVAIEHGSDILVGVGGGKTADTAKIVAIDTGARIVIAPTIASTD
APCSAIAVRYTEHGVYEEALRLPRNPDAVVVDSALVAAAPARFLVAGIGDALSTWFEARS
NIESRTDNYVAGGFPATEAGMAIARHCQDVLTRDAVKAKIAVEAGLLTPAVENIIEANTL
LSGLGFENCGCSAAHGIHDGLTVLEEVHGYFHGEKVAFGTLCLLMLENRDRAEIEAMIRF
CRSVGLPTKLADLGIVDDVPAKIGRVAEAACRPGNIIYATPVTITVPAVRDAILALDAFS
RSIH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory