SitesBLAST
Comparing SMc02041 FitnessBrowser__Smeli:SMc02041 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 94% coverage: 13:250/254 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G26), N111 (= N119), S139 (= S147), Q149 (≠ H157), Y152 (= Y160), K156 (= K164)
- binding acetoacetyl-coenzyme a: D93 (≠ L101), K98 (≠ S106), S139 (= S147), N146 (≠ I154), V147 (≠ E155), Q149 (≠ H157), Y152 (= Y160), F184 (≠ V192), M189 (≠ L199), K200 (≠ R209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G22), N17 (≠ T25), G18 (= G26), I19 (= I27), D38 (= D46), F39 (≠ R47), V59 (≠ A67), D60 (= D68), V61 (= V69), N87 (= N95), A88 (= A96), G89 (= G97), I90 (= I98), T137 (≠ M145), S139 (= S147), Y152 (= Y160), K156 (= K164), P182 (= P190), F184 (≠ V192), T185 (≠ V193), T187 (= T195), M189 (≠ L199)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 96% coverage: 10:252/254 of query aligns to 2:253/255 of 5itvA
- active site: G18 (= G26), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G22), S17 (≠ T25), G18 (= G26), I19 (= I27), D38 (= D46), I39 (≠ R47), T61 (≠ A67), I63 (≠ V69), N89 (= N95), G91 (= G97), T139 (≠ M145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), I186 (≠ V192), I187 (≠ V193)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 96% coverage: 10:252/254 of query aligns to 4:259/261 of 6zzsD
- active site: G18 (= G26), S143 (= S147), Y156 (= Y160)
- binding nicotinamide-adenine-dinucleotide: G14 (= G22), S17 (≠ T25), I19 (= I27), D38 (= D46), M39 (≠ R47), D64 (= D68), V65 (= V69), N91 (= N95), A92 (= A96), G93 (= G97), M141 (= M145), A142 (= A146), S143 (= S147), Y156 (= Y160), K160 (= K164), P186 (= P190), G187 (≠ T191), V189 (= V193), T191 (= T195), L193 (= L197)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ G99), S143 (= S147), N145 (≠ A149), K153 (≠ H157), Y156 (= Y160), Q197 (≠ E205)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
37% identity, 96% coverage: 10:252/254 of query aligns to 3:258/260 of 6zzqA
- active site: G17 (= G26), S142 (= S147), Y155 (= Y160)
- binding acetoacetic acid: Q94 (≠ G99), S142 (= S147), K152 (≠ H157), Y155 (= Y160), Q196 (≠ E205)
- binding nicotinamide-adenine-dinucleotide: G13 (= G22), S16 (≠ T25), G17 (= G26), I18 (= I27), D37 (= D46), M38 (≠ R47), D63 (= D68), V64 (= V69), N90 (= N95), A91 (= A96), G92 (= G97), M140 (= M145), A141 (= A146), S142 (= S147), Y155 (= Y160), K159 (= K164), Y187 (≠ V192), V188 (= V193), T190 (= T195)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
37% identity, 95% coverage: 13:253/254 of query aligns to 3:243/244 of 7krmC
- active site: G18 (= G26), S140 (= S147), Y155 (= Y160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), S15 (≠ T25), G18 (= G26), I19 (= I27), D38 (= D46), L39 (≠ R47), A60 (= A67), N61 (≠ D68), V62 (= V69), N88 (= N95), V111 (= V118), S140 (= S147), Y155 (= Y160), K159 (= K164), I188 (≠ V193), T190 (= T195)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
38% identity, 93% coverage: 16:252/254 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G26), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ I154), R152 (≠ H157), Y155 (= Y160), W195 (= W202), R196 (≠ A203)
- binding nicotinamide-adenine-dinucleotide: G9 (= G22), S12 (≠ T25), G13 (= G26), N14 (≠ I27), D33 (= D46), L34 (≠ R47), A59 (= A67), D60 (= D68), V61 (= V69), N87 (= N95), A88 (= A96), G89 (= G97), I140 (≠ M145), P185 (= P190), G186 (≠ T191), M187 (≠ V192), I188 (≠ V193), T190 (= T195), P191 (≠ E196), M192 (≠ L199), T193 (= T200)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
38% identity, 93% coverage: 16:252/254 of query aligns to 3:248/250 of Q56840
- SGN 12:14 (≠ TGI 25:27) binding
- D33 (= D46) binding
- DV 60:61 (= DV 68:69) binding
- N87 (= N95) binding
- S142 (= S147) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ H157) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y160) mutation Y->E,F: Loss of activity.
- K159 (= K164) mutation to A: Loss of activity.
- R179 (≠ T184) mutation to A: Loss of activity.
- IETP--M 188:192 (≠ VETELGL 193:199) binding
- WR 195:196 (≠ WA 202:203) binding
- R196 (≠ A203) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (vs. gap) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ A213) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 95% coverage: 9:250/254 of query aligns to 2:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G22), S17 (≠ A24), R18 (≠ T25), I20 (= I27), T40 (≠ D46), N62 (≠ D68), V63 (= V69), N89 (= N95), A90 (= A96), I92 (= I98), V139 (≠ M145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), I187 (≠ V193), T189 (= T195), M191 (≠ L197)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
35% identity, 95% coverage: 9:250/254 of query aligns to 2:239/243 of 4i08A
- active site: G19 (= G26), N113 (= N119), S141 (= S147), Q151 (≠ H157), Y154 (= Y160), K158 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G22), S17 (≠ A24), R18 (≠ T25), I20 (= I27), T40 (≠ D46), N62 (≠ D68), V63 (= V69), N89 (= N95), A90 (= A96), G140 (≠ A146), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), T189 (= T195)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
38% identity, 95% coverage: 13:253/254 of query aligns to 5:253/254 of 4fn4A
- active site: G18 (= G26), S144 (= S147), Y157 (= Y160), K161 (= K164), S202 (≠ G204)
- binding nicotinamide-adenine-dinucleotide: G14 (= G22), S17 (≠ T25), G18 (= G26), I19 (= I27), E38 (vs. gap), L39 (vs. gap), R43 (= R47), A63 (= A67), D64 (= D68), V65 (= V69), N91 (= N95), G93 (= G97), I94 (= I98), T142 (≠ M145), S144 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P190), V190 (= V193), T192 (= T195), N193 (≠ E196), I194 (≠ L197)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
38% identity, 93% coverage: 16:250/254 of query aligns to 6:243/247 of 2ewmB
- active site: G16 (= G26), S139 (= S147), Y149 (≠ H157), Y152 (= Y160), K156 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), N15 (≠ T25), G16 (= G26), I17 (= I27), D36 (= D46), L37 (≠ R47), C59 (≠ A67), D60 (= D68), V61 (= V69), N87 (= N95), S139 (= S147), Y152 (= Y160), K156 (= K164), P182 (= P190), S183 (≠ T191), L184 (≠ V192), V185 (= V193), T189 (vs. gap)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
38% identity, 93% coverage: 16:250/254 of query aligns to 8:245/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 96% coverage: 10:252/254 of query aligns to 2:225/227 of 5itvD
- active site: G18 (= G26), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G22), S17 (≠ T25), G18 (= G26), I19 (= I27), D38 (= D46), I39 (≠ R47), T61 (≠ A67), D62 (= D68), I63 (≠ V69), N89 (= N95), T139 (≠ M145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), I187 (≠ V193)
1iy8A Crystal structure of levodione reductase (see paper)
37% identity, 94% coverage: 13:252/254 of query aligns to 2:255/258 of 1iy8A
- active site: G15 (= G26), S143 (= S147), Q153 (≠ H157), Y156 (= Y160), K160 (= K164)
- binding nicotinamide-adenine-dinucleotide: G11 (= G22), S14 (≠ T25), G15 (= G26), L16 (≠ I27), D35 (= D46), V36 (vs. gap), A62 (= A67), D63 (= D68), V64 (= V69), N90 (= N95), G92 (= G97), I93 (= I98), T141 (≠ M145), S143 (= S147), Y156 (= Y160), K160 (= K164), P186 (= P190), G187 (≠ T191), T191 (= T195), P192 (≠ E196), M193 (≠ L197)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
37% identity, 94% coverage: 13:252/254 of query aligns to 11:264/267 of Q9LBG2
- 17:42 (vs. 19:44, 38% identical) binding
- E103 (vs. gap) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 96% coverage: 11:253/254 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G26), S142 (= S147), Q152 (≠ H157), Y155 (= Y160), K159 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G22), S14 (≠ A24), R15 (≠ T25), G16 (= G26), I17 (= I27), N35 (vs. gap), Y36 (≠ L45), N37 (≠ D46), G38 (≠ R47), S39 (≠ D48), N63 (≠ D68), V64 (= V69), N90 (= N95), A91 (= A96), I93 (= I98), I113 (≠ V118), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), I188 (≠ V193), T190 (= T195)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
40% identity, 94% coverage: 13:252/254 of query aligns to 3:237/240 of 2d1yA
- active site: G16 (= G26), S135 (= S147), N145 (≠ H157), Y148 (= Y160), K152 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G22), R15 (≠ T25), I17 (= I27), D36 (= D46), L37 (≠ R47), R38 (≠ D48), V55 (= V66), D56 (= D68), L57 (≠ V69), N83 (= N95), A84 (= A96), A85 (≠ G97), I86 (= I98), V133 (≠ M145), S135 (= S147), Y148 (= Y160), K152 (= K164), P178 (= P190), G179 (≠ T191), I181 (≠ V193), T183 (= T195), A185 (≠ L197), V186 (≠ G198)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 94% coverage: 16:253/254 of query aligns to 6:245/248 of Q9KJF1
- S15 (≠ T25) binding
- D36 (= D46) binding
- D62 (= D68) binding
- I63 (≠ V69) binding
- N89 (= N95) binding
- Y153 (= Y160) binding
- K157 (= K164) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
37% identity, 94% coverage: 16:253/254 of query aligns to 5:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G22), M16 (≠ I27), D35 (= D46), I36 (≠ R47), I62 (≠ V69), N88 (= N95), G90 (= G97), I138 (≠ M145), S140 (= S147), Y152 (= Y160), K156 (= K164), I185 (≠ V193)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
37% identity, 95% coverage: 11:252/254 of query aligns to 1:242/251 of H9XP47
- N15 (≠ T25) binding
- M17 (≠ I27) binding
- D36 (= D46) binding
- D60 (= D68) binding
- V61 (= V69) binding
- N87 (= N95) binding
- S138 (= S147) binding ; binding
- V139 (≠ Q148) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A149) binding
- Y151 (= Y160) binding ; binding ; binding
- K155 (= K164) binding
- V184 (= V193) binding
- T186 (= T195) binding
- RDK 197:199 (≠ GER 207:209) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
Query Sequence
>SMc02041 FitnessBrowser__Smeli:SMc02041
MTEIPSFDDLLDFSGKTVVVTGAATGIGRAVAEAFATKRARVALLDRDAAVSDVAVSLGT
GHIAHVADVTDEQGVERAVKSVTEAFGRIDILINNAGIGPLAPAESYPTAEWDRTLAVNL
KGAFLMARAIAPGMLEQGSGRIVNMASQAAIIGIEGHVAYCASKAGIIGMTNCMALEWGP
RGVTVNAVSPTVVETELGLTGWAGEKGERARAAIPTRRFAKPWEIAASVLYLAGGAAAMV
NGANLMIDGGYTIT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory