SitesBLAST
Comparing SMc02045 FitnessBrowser__Smeli:SMc02045 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eklA Structure of st1218 protein from sulfolobus tokodaii
32% identity, 98% coverage: 5:307/310 of query aligns to 2:308/312 of 2eklA
- active site: S100 (≠ N103), R232 (= R234), D256 (= D258), E261 (= E263), H282 (= H281)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ T79), S100 (≠ N103), G148 (= G151), G150 (= G153), R151 (≠ A154), I152 (= I155), Y170 (≠ H173), D171 (= D174), I172 (vs. gap), L173 (vs. gap), H202 (= H204), V203 (≠ C205), T204 (≠ P206), I212 (= I214), T230 (= T232), S231 (≠ A233), D256 (= D258), G284 (= G283)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 35:290/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 36:291/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T79), A102 (≠ V107), G148 (= G151), R151 (≠ A154), I152 (= I155), Y170 (≠ H173), D171 (= D174), P172 (= P175), I173 (vs. gap), H202 (= H204), T203 (≠ C205), P204 (= P206), T209 (≠ G211), C230 (≠ T232), A231 (= A233), R232 (= R234), H279 (= H281), G281 (= G283)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 34:289/297 of 6rj3A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 35:290/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I150), G147 (= G151), L148 (≠ C152), G149 (= G153), R150 (≠ A154), I151 (= I155), G152 (= G156), D170 (= D174), H201 (= H204), T202 (≠ C205), P203 (= P206)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 35:290/302 of 6rihA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 36:291/305 of 6plfA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 32:287/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G153), I148 (= I155), Y166 (≠ H173), D167 (= D174), P168 (= P175), I169 (vs. gap), I170 (≠ F176), H198 (= H204), T199 (≠ C205), L208 (≠ I214), R228 (= R234)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 81% coverage: 42:293/310 of query aligns to 40:295/533 of O43175
- T78 (= T79) binding
- R135 (= R136) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ AI 154:155) binding
- D175 (= D174) binding
- T207 (≠ C205) binding
- CAR 234:236 (≠ TAR 232:234) binding
- D260 (= D258) binding
- V261 (= V259) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGG 281:284) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 35:290/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
33% identity, 81% coverage: 42:293/310 of query aligns to 34:289/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N103), A100 (≠ V107), R149 (≠ A154), I150 (= I155), Y168 (≠ H173), D169 (= D174), P170 (= P175), I171 (vs. gap), H200 (= H204), T201 (≠ C205), P202 (= P206), T207 (≠ G211), C228 (≠ T232), A229 (= A233), R230 (= R234), H277 (= H281), G279 (= G283)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 74% coverage: 64:293/310 of query aligns to 49:281/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ A154), Y160 (≠ H173), D161 (= D174), P162 (= P175), I164 (≠ F176), L179 (= L191), T193 (≠ C205), P194 (= P206), S198 (≠ D210), L202 (≠ I214)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 89% coverage: 19:293/310 of query aligns to 14:290/304 of 1wwkA
- active site: S96 (≠ N103), R230 (= R234), D254 (= D258), E259 (= E263), H278 (= H281)
- binding nicotinamide-adenine-dinucleotide: V100 (= V107), G146 (= G151), F147 (≠ C152), G148 (= G153), R149 (≠ A154), I150 (= I155), Y168 (≠ H173), D169 (= D174), P170 (= P175), V201 (≠ C205), P202 (= P206), T207 (≠ G211), T228 (= T232), S229 (≠ A233), D254 (= D258), H278 (= H281), G280 (= G283)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
37% identity, 83% coverage: 38:293/310 of query aligns to 31:290/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
37% identity, 83% coverage: 38:293/310 of query aligns to 30:289/526 of 3dc2A
Sites not aligning to the query:
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
34% identity, 89% coverage: 26:301/310 of query aligns to 31:319/336 of 5z20F
- active site: S108 (≠ N103), R241 (= R234), D265 (= D258), E270 (= E263), H302 (= H281)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (≠ A102), G160 (= G153), Q161 (≠ A154), I162 (= I155), Y180 (≠ H173), D181 (= D174), P182 (= P175), C212 (= C205), P213 (= P206), T218 (≠ G211), T239 (= T232), G240 (≠ A233), R241 (= R234), H302 (= H281), A304 (≠ G283)
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
28% identity, 77% coverage: 68:305/310 of query aligns to 66:319/330 of 1dxyA
- active site: S101 (≠ N103), R234 (= R234), D258 (= D258), E263 (= E263), H295 (= H281)
- binding 2-oxo-4-methylpentanoic acid: V77 (≠ T79), Y100 (≠ A102), Y298 (≠ G284)
- binding nicotinamide-adenine-dinucleotide: Y100 (≠ A102), G152 (= G151), G154 (= G153), H155 (≠ A154), I156 (= I155), Y174 (≠ H173), D175 (= D174), P176 (= P175), H204 (= H204), V205 (≠ C205), P206 (= P206), N211 (≠ G211), T232 (= T232), A233 (= A233), R234 (= R234), H295 (= H281), Y298 (≠ G284)
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
28% identity, 77% coverage: 68:305/310 of query aligns to 66:319/333 of P17584
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
29% identity, 91% coverage: 21:301/310 of query aligns to 29:331/346 of 4zgsA
- active site: S111 (≠ N103), R244 (= R234), D268 (= D258), E273 (= E263), H311 (= H281)
- binding nicotinamide-adenine-dinucleotide: Y110 (≠ A102), G163 (= G153), A164 (= A154), I165 (= I155), D184 (= D174), C215 (= C205), P216 (= P206), L218 (≠ P208), S220 (≠ D210), T221 (≠ G211), S243 (≠ A233), H311 (= H281), F314 (≠ G284)
5z21B The ternary structure of d-lactate dehydrogenase from fusobacterium nucleatum with nadh and oxamate (see paper)
29% identity, 91% coverage: 26:306/310 of query aligns to 25:321/331 of 5z21B
- active site: S101 (≠ N103), R235 (= R234), D259 (= D258), E264 (vs. gap), H296 (= H281)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (≠ A102), I105 (≠ V107), G153 (= G153), K154 (≠ A154), I155 (= I155), D174 (= D174), L175 (≠ P175), P207 (= P206), T212 (≠ G211), T233 (= T232), G234 (≠ A233), R235 (= R234), H296 (= H281), Y299 (≠ G284)
Query Sequence
>SMc02045 FitnessBrowser__Smeli:SMc02045
MKRILVTPRSLSLAPPPELEPLRQAGFELVFSTPGRMPDEAELIDLVPGCVGWLAGVEPV
SDRVIAAADSLRAISRNGTGIDNLPLSLLKGRGIRVLKAEGANAVGVAELAVGLILAALR
HIPAETAGIRAGGWPRSRGKEIAERTVGIIGCGAIGKRVARAVSAMRASVIAHDPFRPNV
EVYGPFKWGSLDEVFAEADIVSLHCPAPADGRPIVDAARLAAVPPHAILINTARATLVDE
VAVRAALDEGRLQAYATDVFVEEPPAPGSLASHPRVIATSHIGGLTDESVSKATAIAVTN
LLSALEEESA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory