Comparing SMc02087 FitnessBrowser__Smeli:SMc02087 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
69% identity, 99% coverage: 5:429/429 of query aligns to 2:426/426 of 2h12B
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
68% identity, 100% coverage: 1:429/429 of query aligns to 1:427/427 of P0ABH7
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
68% identity, 100% coverage: 2:429/429 of query aligns to 1:426/426 of 1owbA
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
68% identity, 100% coverage: 2:429/429 of query aligns to 1:426/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
68% identity, 100% coverage: 2:429/429 of query aligns to 1:426/426 of 4jaeA
1nxgA The f383a variant of type ii citrate synthase complexed with nadh (see paper)
68% identity, 100% coverage: 2:429/429 of query aligns to 1:426/426 of 1nxgA
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
54% identity, 100% coverage: 2:429/429 of query aligns to 4:431/431 of P9WPD5
3msuB Crystal structure of citrate synthase from francisella tularensis
55% identity, 98% coverage: 4:423/429 of query aligns to 10:426/426 of 3msuB
3msuA Crystal structure of citrate synthase from francisella tularensis
53% identity, 98% coverage: 4:423/429 of query aligns to 10:415/415 of 3msuA
4tvmA Structure of citrate synthase from mycobacterium tuberculosis (see paper)
49% identity, 98% coverage: 5:426/429 of query aligns to 1:380/380 of 4tvmA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
40% identity, 87% coverage: 55:429/429 of query aligns to 8:369/369 of 6abwA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
35% identity, 90% coverage: 46:429/429 of query aligns to 6:370/372 of 6abyA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
35% identity, 90% coverage: 46:429/429 of query aligns to 6:370/370 of 6abxA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
37% identity, 88% coverage: 54:429/429 of query aligns to 12:370/371 of 1aj8A
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 90% coverage: 46:429/429 of query aligns to 4:374/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 90% coverage: 46:429/429 of query aligns to 4:371/371 of 1ixeA
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
33% identity, 90% coverage: 46:429/429 of query aligns to 6:371/372 of P39120
2ifcC The structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
35% identity, 87% coverage: 55:429/429 of query aligns to 16:381/382 of 2ifcC
2r9eA The structure of the binary complex of citryl dethia coa and citrate synthase from the thermophilic archaeonthermoplasma acidophilum
35% identity, 87% coverage: 55:429/429 of query aligns to 16:381/381 of 2r9eA
2r26A The structure of the ternary complex of carboxymethyl coenzyme a and oxalateacetate with citrate synthase from the thermophilic archaeonthermoplasma acidophilum
35% identity, 87% coverage: 55:429/429 of query aligns to 16:381/381 of 2r26A
>SMc02087 FitnessBrowser__Smeli:SMc02087
MSEKSATVTFGGKSADLPVRSGSIGPDVVDIGSLYKQTTMFTYDPGFTSTASCESKITYI
DGDEGVLLHRGFPIEQLAEHGDFLEVCYLLLYGELPTKAQKADFDYRVTHHTMVHEQMSR
FFTGFRRDAHPMAVMCGCVGALSAFYHDSTDITDPHQRMVASLRMIAKMPTIAAMAYKYH
IGQPFVYPKNDLDYASNFLRMCFAVPCEEYVVNPVLARAMDRIFILHADHEQNASTSTVR
LAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLAEIGTVDRIPEYITKAKDKNDPFR
LMGFGHRVYKNYDPRAKIMQKTTHEVLAELGHKDDPLLEVAMELERIALTDEYFIEKKLY
PNIDFYSGITLKALGFPTTMFTVLFALARTVGWIAQWNEMIEDPEQRIGRPRQLYVGAPL
RDYVPISKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory