Comparing SMc02093 FitnessBrowser__Smeli:SMc02093 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ihhE Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
37% identity, 96% coverage: 10:348/354 of query aligns to 2:330/340 of 4ihhE
2iu8A Chlamydia trachomatis lpxd with 25mm udpglcnac (complex i) (see paper)
39% identity, 85% coverage: 39:338/354 of query aligns to 30:327/346 of 2iu8A
P0CD76 UDP-3-O-acylglucosamine N-acyltransferase; EC 2.3.1.191 from Chlamydia trachomatis (strain D/UW-3/Cx) (see paper)
39% identity, 85% coverage: 39:338/354 of query aligns to 30:327/354 of P0CD76
P21645 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase; UDP-3-O-(3-OHC14)-GlcN N-acyltransferase; Protein FirA; Rifampicin resistance protein; UDP-3-O-(3-hydroxytetradecanoyl)glucosamine N-acyltransferase; EC 2.3.1.191 from Escherichia coli (strain K12) (see 4 papers)
36% identity, 96% coverage: 13:353/354 of query aligns to 4:341/341 of P21645
Sites not aligning to the query:
6p8aA E.Coli lpxd in complex with compound 8.1 (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p8aA
6p89A E.Coli lpxd in complex with compound 7 (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p89A
6p88A E.Coli lpxd in complex with compound 6 (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p88A
6p87A E.Coli lpxd in complex with compound 5 (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p87A
6p86A E.Coli lpxd in complex with compound 4.1 (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p86A
6p85A E.Coli lpxd in complex with compound 3 (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p85A
6p84A E.Coli lpxd in complex with compound 2o (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p84A
6p83A E.Coli lpxd in complex with compound 1o (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/335 of 6p83A
4ihgE Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 3:328/337 of 4ihgE
P0A1X4 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase; UDP-3-O-(3-OHC14)-GlcN N-acyltransferase; UDP-3-O-(3-hydroxytetradecanoyl)glucosamine N-acyltransferase; EC 2.3.1.191 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 95% coverage: 13:348/354 of query aligns to 4:329/341 of P0A1X4
4ihfA Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
37% identity, 95% coverage: 13:348/354 of query aligns to 2:327/336 of 4ihfA
3pmoA The structure of lpxd from pseudomonas aeruginosa at 1.3 a resolution (see paper)
36% identity, 94% coverage: 15:348/354 of query aligns to 26:356/357 of 3pmoA
Sites not aligning to the query:
6uecA Pseudomonas aeruginosa lpxd complex structure with ligand (see paper)
36% identity, 94% coverage: 15:348/354 of query aligns to 6:336/337 of 6uecA
7ojwA Crystal structure of pseudomonas aeruginosa lpxa in complex with compound 93 (see paper)
30% identity, 58% coverage: 119:325/354 of query aligns to 4:186/256 of 7ojwA
5dg3A Structure of pseudomonas aeruginosa lpxa in complex with udp-3-o-(r-3- hydroxydecanoyl)-glcnac (see paper)
30% identity, 58% coverage: 119:325/354 of query aligns to 2:186/256 of 5dg3A
Sites not aligning to the query:
4eqyG Crystal structure of acyl-[acyl-carrier-protein]--udp-n- acetylglucosamine o-acyltransferase from burkholderia thailandensis (see paper)
31% identity, 64% coverage: 119:345/354 of query aligns to 2:214/260 of 4eqyG
>SMc02093 FitnessBrowser__Smeli:SMc02093
MEQNWFFPPHQGIRLGDLANQIGAELLDISAADRTVRAVAPVYRAKPGDICYMLSRKNRE
ELQTCRAAAIICDKAISSLVPDTIPVLLTSKPHTAFALAGTLLHERAMRPSYNTSERGVA
PEAFVDPTARLEAGVEVEPMAVIGAGAEIGSGTRIAAGAMIGQGVRIGRDCTISAGASIL
CALIGNNVIIHPGARIGQDGFGYAPGPKGGMIKIVQVGRVIIQDHVEIGANTTIDRGTMD
DTVIGEGTKIDNLVQIGHNVRIGRYCGIVSQVGIAGSTQIGDGVMIGGGVGVNGHITIGD
GAQIAAMSGVASDVPAGERYGGIPARPMRDFLRDVAEMALRSSERQKKKGGKDE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory